Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067NN90

Protein Details
Accession A0A067NN90    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-35TSSGGGKAAKKKKWSKGKVKDKAQHAITHydrophilic
NLS Segment(s)
PositionSequence
9-29SSGGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAPTSSGGGKAAKKKKWSKGKVKDKAQHAITLDKALFDRIIKEVPTFKFISQSILIERLKINGSLARIAIRHLEKDGQIKRIVHHSAQLVYSRTTAGTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.5
3 0.51
4 0.57
5 0.64
6 0.68
7 0.75
8 0.8
9 0.82
10 0.84
11 0.9
12 0.9
13 0.91
14 0.88
15 0.84
16 0.82
17 0.72
18 0.65
19 0.56
20 0.49
21 0.39
22 0.35
23 0.28
24 0.2
25 0.18
26 0.15
27 0.13
28 0.1
29 0.11
30 0.09
31 0.11
32 0.1
33 0.11
34 0.16
35 0.16
36 0.19
37 0.19
38 0.18
39 0.2
40 0.19
41 0.22
42 0.17
43 0.17
44 0.15
45 0.19
46 0.19
47 0.17
48 0.17
49 0.15
50 0.15
51 0.14
52 0.14
53 0.11
54 0.12
55 0.12
56 0.13
57 0.13
58 0.12
59 0.13
60 0.17
61 0.17
62 0.17
63 0.18
64 0.2
65 0.21
66 0.3
67 0.33
68 0.32
69 0.35
70 0.35
71 0.35
72 0.4
73 0.42
74 0.34
75 0.35
76 0.34
77 0.32
78 0.33
79 0.35
80 0.29
81 0.27
82 0.27
83 0.23