Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067NFK5

Protein Details
Accession A0A067NFK5   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
22-50GPQQSASARRRSRNRRGRSRTPRSLSASSHydrophilic
170-197AGGHQVQHHAPRRRRRRRGASAKGNAVEBasic
NLS Segment(s)
PositionSequence
29-44ARRRSRNRRGRSRTPR
59-68PRRKRGGKKG
179-192APRRRRRRRGASAK
Subcellular Location(s) nucl 13.5, cyto_nucl 11, mito 7, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSQPASRAQCRASSVASDHEGGPQQSASARRRSRNRRGRSRTPRSLSASSEDTGPHDVPRRKRGGKKGGLPAVGEVDEAAGAVGNTATGAVDTVGDVAGSVAGGGGGGDKPLKLRLDLNLEVEITLKARVHGDLTLALFMPQSTQASSPASATGVNGHHNIPGDRSPSSAGGHQVQHHAPRRRRRRRGASAKGNAVEKAQLAEVDGNEDDKNVGAIRLDLNLEVDLTLKARLRGDLTLCLEAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.32
4 0.29
5 0.25
6 0.26
7 0.27
8 0.24
9 0.23
10 0.18
11 0.16
12 0.19
13 0.26
14 0.26
15 0.33
16 0.4
17 0.47
18 0.58
19 0.68
20 0.75
21 0.79
22 0.85
23 0.86
24 0.89
25 0.91
26 0.92
27 0.92
28 0.92
29 0.88
30 0.85
31 0.81
32 0.75
33 0.67
34 0.6
35 0.53
36 0.42
37 0.37
38 0.29
39 0.24
40 0.23
41 0.21
42 0.19
43 0.25
44 0.3
45 0.36
46 0.44
47 0.51
48 0.56
49 0.64
50 0.71
51 0.73
52 0.75
53 0.77
54 0.78
55 0.75
56 0.68
57 0.6
58 0.5
59 0.42
60 0.33
61 0.24
62 0.15
63 0.09
64 0.07
65 0.06
66 0.05
67 0.03
68 0.02
69 0.03
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.02
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.03
95 0.03
96 0.03
97 0.04
98 0.07
99 0.08
100 0.08
101 0.1
102 0.12
103 0.19
104 0.2
105 0.21
106 0.19
107 0.18
108 0.17
109 0.17
110 0.14
111 0.08
112 0.08
113 0.06
114 0.06
115 0.07
116 0.07
117 0.07
118 0.07
119 0.07
120 0.08
121 0.08
122 0.08
123 0.08
124 0.07
125 0.06
126 0.06
127 0.06
128 0.05
129 0.06
130 0.06
131 0.07
132 0.08
133 0.1
134 0.1
135 0.1
136 0.09
137 0.09
138 0.09
139 0.08
140 0.1
141 0.1
142 0.12
143 0.12
144 0.12
145 0.13
146 0.15
147 0.15
148 0.14
149 0.16
150 0.16
151 0.15
152 0.16
153 0.16
154 0.17
155 0.18
156 0.17
157 0.17
158 0.18
159 0.21
160 0.21
161 0.24
162 0.25
163 0.31
164 0.39
165 0.45
166 0.5
167 0.58
168 0.68
169 0.75
170 0.83
171 0.86
172 0.88
173 0.9
174 0.93
175 0.94
176 0.93
177 0.9
178 0.86
179 0.79
180 0.7
181 0.59
182 0.49
183 0.39
184 0.28
185 0.22
186 0.15
187 0.11
188 0.11
189 0.12
190 0.11
191 0.13
192 0.13
193 0.13
194 0.12
195 0.13
196 0.11
197 0.1
198 0.11
199 0.08
200 0.08
201 0.07
202 0.08
203 0.09
204 0.11
205 0.11
206 0.1
207 0.11
208 0.11
209 0.11
210 0.1
211 0.1
212 0.09
213 0.09
214 0.12
215 0.13
216 0.15
217 0.17
218 0.19
219 0.21
220 0.25
221 0.27
222 0.31
223 0.34