Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067NPJ2

Protein Details
Accession A0A067NPJ2    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
68-87QWEAKWKKSTHRAKLERVDPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 7pero 7, nucl 6.5, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002156  RNaseH_domain  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0004523  F:RNA-DNA hybrid ribonuclease activity  
PROSITE View protein in PROSITE  
PS50879  RNASE_H_1  
Amino Acid Sequences LQWISAHDDVAGNEQADTLGKEAATGKAQPAEYCPLLLHDLCCPYNLPKLLYNKAAVCKEARQRVSLQWEAKWKKSTHRAKLERVDPGLKVGKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.12
5 0.08
6 0.07
7 0.07
8 0.08
9 0.09
10 0.11
11 0.12
12 0.12
13 0.12
14 0.15
15 0.16
16 0.15
17 0.17
18 0.19
19 0.18
20 0.17
21 0.16
22 0.14
23 0.15
24 0.15
25 0.13
26 0.11
27 0.14
28 0.13
29 0.14
30 0.13
31 0.13
32 0.17
33 0.17
34 0.17
35 0.19
36 0.23
37 0.26
38 0.27
39 0.27
40 0.25
41 0.29
42 0.28
43 0.25
44 0.22
45 0.25
46 0.3
47 0.36
48 0.35
49 0.33
50 0.34
51 0.38
52 0.44
53 0.45
54 0.4
55 0.36
56 0.45
57 0.47
58 0.5
59 0.52
60 0.46
61 0.49
62 0.57
63 0.64
64 0.64
65 0.71
66 0.73
67 0.76
68 0.83
69 0.8
70 0.77
71 0.72
72 0.65
73 0.54
74 0.53