Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067NFT5

Protein Details
Accession A0A067NFT5    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRLRRSRAHHARRDVHRASRBasic
74-99ALQSHWKSKVHKRRCKQLREPAYTIEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MGRLRRSRAHHARRDVHRASRTRVRTKDLDQIQLIDLDPKNRANLEAQPIDFDTPGLAQHYCVECAKYYETDHALQSHWKSKVHKRRCKQLREPAYTIEEAERAAGLGRETKKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.8
3 0.78
4 0.76
5 0.72
6 0.69
7 0.69
8 0.7
9 0.7
10 0.68
11 0.65
12 0.63
13 0.62
14 0.64
15 0.59
16 0.56
17 0.47
18 0.44
19 0.38
20 0.32
21 0.28
22 0.23
23 0.19
24 0.15
25 0.17
26 0.16
27 0.16
28 0.15
29 0.16
30 0.14
31 0.17
32 0.21
33 0.22
34 0.21
35 0.21
36 0.21
37 0.21
38 0.18
39 0.14
40 0.08
41 0.06
42 0.06
43 0.06
44 0.06
45 0.05
46 0.08
47 0.09
48 0.1
49 0.11
50 0.11
51 0.1
52 0.12
53 0.13
54 0.12
55 0.13
56 0.14
57 0.17
58 0.17
59 0.18
60 0.17
61 0.17
62 0.19
63 0.21
64 0.25
65 0.25
66 0.28
67 0.33
68 0.43
69 0.53
70 0.6
71 0.67
72 0.68
73 0.77
74 0.83
75 0.88
76 0.88
77 0.88
78 0.87
79 0.86
80 0.81
81 0.74
82 0.69
83 0.59
84 0.5
85 0.4
86 0.3
87 0.21
88 0.19
89 0.14
90 0.09
91 0.09
92 0.09
93 0.09
94 0.15