Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067NEM4

Protein Details
Accession A0A067NEM4    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
17-40ASPDIEERKKKKKIRRPTVTATPPHydrophilic
NLS Segment(s)
PositionSequence
24-32RKKKKKIRR
Subcellular Location(s) extr 8, mito 6, cyto 5.5, cyto_nucl 4.5, nucl 2.5, plas 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MRIALLLLVCAAVLVVASPDIEERKKKKKIRRPTVTATPPAPAAVADVPAADAPPAAVSSAAYAEKPDRHTSTRGFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.03
3 0.03
4 0.03
5 0.03
6 0.05
7 0.08
8 0.11
9 0.19
10 0.25
11 0.35
12 0.45
13 0.53
14 0.62
15 0.7
16 0.78
17 0.82
18 0.86
19 0.84
20 0.82
21 0.84
22 0.79
23 0.72
24 0.62
25 0.51
26 0.41
27 0.33
28 0.25
29 0.15
30 0.11
31 0.07
32 0.07
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.04
39 0.04
40 0.03
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.05
47 0.07
48 0.08
49 0.08
50 0.09
51 0.13
52 0.17
53 0.22
54 0.28
55 0.31
56 0.34
57 0.39