Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067P9C8

Protein Details
Accession A0A067P9C8    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
74-93CRSNRARSVVWRCRKARRLDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MDHRFERLDLRDLNAGGAFELQRIRDPWLTKRLKWISLSMWTLAQVLTEECCRSETLRNAPKTNLAVLTFLSGCRSNRARSVVWRCRKARRLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.16
4 0.16
5 0.12
6 0.1
7 0.11
8 0.1
9 0.12
10 0.14
11 0.18
12 0.2
13 0.23
14 0.28
15 0.37
16 0.41
17 0.39
18 0.48
19 0.48
20 0.48
21 0.46
22 0.43
23 0.36
24 0.37
25 0.37
26 0.28
27 0.24
28 0.2
29 0.18
30 0.15
31 0.12
32 0.07
33 0.05
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.08
40 0.09
41 0.14
42 0.18
43 0.27
44 0.35
45 0.39
46 0.4
47 0.4
48 0.43
49 0.39
50 0.36
51 0.28
52 0.22
53 0.18
54 0.16
55 0.18
56 0.14
57 0.13
58 0.14
59 0.14
60 0.14
61 0.21
62 0.24
63 0.25
64 0.3
65 0.35
66 0.36
67 0.43
68 0.53
69 0.57
70 0.64
71 0.71
72 0.71
73 0.77