Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067N4Z1

Protein Details
Accession A0A067N4Z1   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
79-105VLAARVKQTRDANRKRRPAPFKNGDLVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MIRQCIEPSQKDWVLRLPAIEFAINSARSESTGYAPFFLNNGRMPRSLLWDSPSKDEFPGVRVFAQHIKHVLMSAHDSVLAARVKQTRDANRKRRPAPFKNGDLVYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.34
4 0.26
5 0.25
6 0.25
7 0.23
8 0.17
9 0.14
10 0.18
11 0.17
12 0.16
13 0.15
14 0.13
15 0.13
16 0.15
17 0.14
18 0.13
19 0.17
20 0.17
21 0.17
22 0.17
23 0.16
24 0.16
25 0.15
26 0.15
27 0.13
28 0.16
29 0.17
30 0.17
31 0.18
32 0.19
33 0.24
34 0.23
35 0.21
36 0.21
37 0.24
38 0.25
39 0.27
40 0.27
41 0.21
42 0.2
43 0.21
44 0.18
45 0.15
46 0.16
47 0.14
48 0.13
49 0.12
50 0.14
51 0.18
52 0.19
53 0.18
54 0.17
55 0.17
56 0.17
57 0.17
58 0.16
59 0.12
60 0.14
61 0.13
62 0.12
63 0.11
64 0.11
65 0.1
66 0.14
67 0.14
68 0.1
69 0.14
70 0.18
71 0.2
72 0.27
73 0.35
74 0.4
75 0.51
76 0.62
77 0.68
78 0.74
79 0.83
80 0.84
81 0.86
82 0.86
83 0.85
84 0.85
85 0.84
86 0.8
87 0.78