Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067NS41

Protein Details
Accession A0A067NS41    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
90-118HTKGKMEYIFKKKRRKGYQKTITHKQPYTHydrophilic
NLS Segment(s)
PositionSequence
100-105KKKRRK
Subcellular Location(s) mito 15.5, mito_nucl 12.499, nucl 8, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
IPR001787  Ribosomal_L21  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences MQAAQPGSVTSALQLVKSQPSQYVVASLAGRKYLLAPRDVLTVPRMRDVKVGDVLTLNEVHELGSREYTIRGNPVIPPSRVKVEATVIEHTKGKMEYIFKKKRRKGYQKTITHKQPYTRIRIGSIDIPAVEASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.19
4 0.21
5 0.22
6 0.19
7 0.22
8 0.24
9 0.22
10 0.22
11 0.18
12 0.19
13 0.19
14 0.18
15 0.16
16 0.15
17 0.14
18 0.12
19 0.14
20 0.16
21 0.17
22 0.17
23 0.18
24 0.18
25 0.22
26 0.22
27 0.2
28 0.19
29 0.22
30 0.21
31 0.25
32 0.25
33 0.22
34 0.25
35 0.25
36 0.25
37 0.25
38 0.24
39 0.19
40 0.19
41 0.18
42 0.16
43 0.15
44 0.11
45 0.07
46 0.06
47 0.06
48 0.07
49 0.09
50 0.08
51 0.08
52 0.08
53 0.09
54 0.1
55 0.1
56 0.09
57 0.09
58 0.09
59 0.09
60 0.11
61 0.16
62 0.19
63 0.2
64 0.22
65 0.22
66 0.25
67 0.26
68 0.25
69 0.2
70 0.19
71 0.22
72 0.22
73 0.23
74 0.21
75 0.22
76 0.22
77 0.21
78 0.2
79 0.17
80 0.15
81 0.15
82 0.19
83 0.27
84 0.37
85 0.47
86 0.53
87 0.64
88 0.7
89 0.78
90 0.83
91 0.86
92 0.86
93 0.87
94 0.89
95 0.89
96 0.91
97 0.9
98 0.89
99 0.86
100 0.8
101 0.75
102 0.74
103 0.71
104 0.71
105 0.67
106 0.59
107 0.54
108 0.52
109 0.49
110 0.43
111 0.38
112 0.31
113 0.25
114 0.24