Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067NI97

Protein Details
Accession A0A067NI97   
Localization Confidence High
Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-28AADKAEKAPRKGKKDPKAPKRALSAYHydrophilic
102-132SSLLSNRIARRAKRRKKRKTRTTRTTIKYTLHydrophilic
NLS Segment(s)
PositionSequence
5-23DKAEKAPRKGKKDPKAPKR
109-122IARRAKRRKKRKTR
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences RKAADKAEKAPRKGKKDPKAPKRALSAYMFFSQDWRERIKAENPDAGFGEVGKLLGAKWKEMDDEDKKPYVEQANKDKTRAEEEKNAYDVRTFLSFLINVLSSLLSNRIARRAKRRKKRKTRTTRTTIKYTLVHCPSDVLIPAGTLLPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.78
3 0.81
4 0.86
5 0.88
6 0.9
7 0.88
8 0.84
9 0.82
10 0.75
11 0.7
12 0.64
13 0.56
14 0.49
15 0.45
16 0.4
17 0.31
18 0.29
19 0.27
20 0.26
21 0.26
22 0.26
23 0.24
24 0.24
25 0.29
26 0.34
27 0.38
28 0.37
29 0.41
30 0.37
31 0.37
32 0.37
33 0.33
34 0.25
35 0.17
36 0.14
37 0.08
38 0.08
39 0.06
40 0.05
41 0.04
42 0.09
43 0.09
44 0.09
45 0.1
46 0.11
47 0.11
48 0.13
49 0.2
50 0.2
51 0.24
52 0.27
53 0.28
54 0.27
55 0.26
56 0.28
57 0.27
58 0.27
59 0.28
60 0.34
61 0.42
62 0.43
63 0.44
64 0.43
65 0.38
66 0.4
67 0.39
68 0.34
69 0.33
70 0.35
71 0.37
72 0.38
73 0.37
74 0.3
75 0.26
76 0.22
77 0.15
78 0.13
79 0.11
80 0.09
81 0.1
82 0.1
83 0.09
84 0.11
85 0.09
86 0.08
87 0.07
88 0.07
89 0.06
90 0.06
91 0.08
92 0.09
93 0.11
94 0.12
95 0.2
96 0.26
97 0.32
98 0.43
99 0.52
100 0.61
101 0.7
102 0.81
103 0.84
104 0.89
105 0.95
106 0.95
107 0.95
108 0.96
109 0.96
110 0.95
111 0.94
112 0.89
113 0.86
114 0.78
115 0.72
116 0.66
117 0.58
118 0.58
119 0.52
120 0.47
121 0.38
122 0.37
123 0.32
124 0.29
125 0.27
126 0.19
127 0.14
128 0.13
129 0.13