Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067NZB3

Protein Details
Accession A0A067NZB3    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
81-123PLDLRPKKTRAIRRRLTKHEGSLKTLKQKKKDQNFPIRKYAVKHydrophilic
NLS Segment(s)
PositionSequence
84-112LRPKKTRAIRRRLTKHEGSLKTLKQKKKD
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLTKQLTELKNELLTLRVQKIAGGSASKLTKINTVRKSIARVLTVINHKSRQNLREYYKDKKFLPLDLRPKKTRAIRRRLTKHEGSLKTLKQKKKDQNFPIRKYAVKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.54
5 0.5
6 0.49
7 0.48
8 0.53
9 0.49
10 0.47
11 0.46
12 0.39
13 0.34
14 0.29
15 0.26
16 0.18
17 0.18
18 0.18
19 0.18
20 0.17
21 0.16
22 0.16
23 0.17
24 0.16
25 0.15
26 0.12
27 0.11
28 0.13
29 0.14
30 0.14
31 0.15
32 0.14
33 0.19
34 0.24
35 0.32
36 0.32
37 0.37
38 0.39
39 0.4
40 0.43
41 0.41
42 0.39
43 0.31
44 0.27
45 0.23
46 0.25
47 0.27
48 0.26
49 0.24
50 0.24
51 0.24
52 0.29
53 0.32
54 0.31
55 0.33
56 0.37
57 0.38
58 0.45
59 0.49
60 0.52
61 0.54
62 0.56
63 0.51
64 0.52
65 0.49
66 0.45
67 0.49
68 0.49
69 0.53
70 0.57
71 0.64
72 0.59
73 0.6
74 0.61
75 0.63
76 0.65
77 0.64
78 0.65
79 0.68
80 0.76
81 0.83
82 0.85
83 0.84
84 0.79
85 0.78
86 0.77
87 0.71
88 0.67
89 0.65
90 0.62
91 0.64
92 0.66
93 0.64
94 0.63
95 0.7
96 0.74
97 0.77
98 0.83
99 0.83
100 0.86
101 0.9
102 0.87
103 0.87
104 0.81
105 0.73