Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067NNU9

Protein Details
Accession A0A067NNU9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
245-265DGGGQKKKKKKEGPGVTARNMBasic
NLS Segment(s)
PositionSequence
249-257QKKKKKKEG
Subcellular Location(s) nucl 12, mito 11, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045144  TAF4  
IPR007900  TAF4_C  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF05236  TAF4  
CDD cd08045  TAF4  
Amino Acid Sequences MAPYVATTPYAHYQNYYTQASYYQQYAAQTATQATATTAAPIQAAQAPRTTAQQQPASNAMETDVATLNDALGSAGVDLRAEEETLQRQNDHHHSYRPYEDRTRKQPPIPSFNNQFLSQTMRTFATPHKVTKIPEDSVNYLALALRTRLQDLVTAMIAASHHRNDTQFDRPASLYEDGTPMWSLLVRSDVAKQLAALEKVEREEELKVRRERKERADMAAAQAAQLAAQAAGGANAMAVDSFDDDGGGQKKKKKKEGPGVTARNMSEDVRKKMSNAVASQAAGLGGKYAWMTAANAATPAKPKPAPAATGATSPATTTTPATGSSAASSWARPYVSTKKAPSSSSAPTNEEDVRTTVTMRDALFVIEKERGHGGGRGAARLCI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.35
4 0.3
5 0.27
6 0.3
7 0.31
8 0.3
9 0.26
10 0.21
11 0.21
12 0.21
13 0.22
14 0.2
15 0.18
16 0.17
17 0.16
18 0.15
19 0.13
20 0.12
21 0.12
22 0.12
23 0.11
24 0.12
25 0.11
26 0.11
27 0.11
28 0.1
29 0.11
30 0.14
31 0.16
32 0.15
33 0.17
34 0.18
35 0.19
36 0.24
37 0.25
38 0.26
39 0.31
40 0.37
41 0.36
42 0.37
43 0.41
44 0.39
45 0.36
46 0.31
47 0.25
48 0.2
49 0.18
50 0.17
51 0.14
52 0.11
53 0.12
54 0.11
55 0.1
56 0.08
57 0.08
58 0.06
59 0.05
60 0.05
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.06
67 0.06
68 0.06
69 0.07
70 0.09
71 0.14
72 0.18
73 0.19
74 0.19
75 0.19
76 0.26
77 0.33
78 0.38
79 0.36
80 0.39
81 0.42
82 0.46
83 0.53
84 0.51
85 0.5
86 0.53
87 0.59
88 0.61
89 0.66
90 0.71
91 0.69
92 0.69
93 0.71
94 0.69
95 0.69
96 0.67
97 0.65
98 0.61
99 0.61
100 0.59
101 0.51
102 0.44
103 0.36
104 0.36
105 0.3
106 0.25
107 0.21
108 0.18
109 0.18
110 0.19
111 0.21
112 0.23
113 0.25
114 0.27
115 0.3
116 0.32
117 0.33
118 0.39
119 0.41
120 0.34
121 0.35
122 0.37
123 0.34
124 0.32
125 0.31
126 0.23
127 0.18
128 0.16
129 0.13
130 0.1
131 0.08
132 0.1
133 0.1
134 0.11
135 0.11
136 0.11
137 0.12
138 0.12
139 0.13
140 0.1
141 0.09
142 0.08
143 0.08
144 0.08
145 0.07
146 0.09
147 0.08
148 0.08
149 0.1
150 0.1
151 0.13
152 0.17
153 0.22
154 0.25
155 0.25
156 0.26
157 0.26
158 0.26
159 0.26
160 0.23
161 0.17
162 0.13
163 0.14
164 0.12
165 0.12
166 0.11
167 0.08
168 0.06
169 0.06
170 0.06
171 0.05
172 0.06
173 0.06
174 0.07
175 0.08
176 0.1
177 0.1
178 0.1
179 0.1
180 0.11
181 0.13
182 0.12
183 0.11
184 0.1
185 0.1
186 0.11
187 0.11
188 0.09
189 0.08
190 0.1
191 0.13
192 0.18
193 0.25
194 0.3
195 0.36
196 0.43
197 0.48
198 0.53
199 0.56
200 0.61
201 0.56
202 0.54
203 0.52
204 0.47
205 0.42
206 0.38
207 0.3
208 0.2
209 0.18
210 0.14
211 0.09
212 0.08
213 0.06
214 0.03
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.02
222 0.02
223 0.02
224 0.02
225 0.02
226 0.02
227 0.03
228 0.03
229 0.03
230 0.04
231 0.04
232 0.07
233 0.11
234 0.14
235 0.17
236 0.23
237 0.3
238 0.38
239 0.49
240 0.54
241 0.61
242 0.69
243 0.76
244 0.8
245 0.83
246 0.82
247 0.75
248 0.71
249 0.6
250 0.51
251 0.42
252 0.34
253 0.31
254 0.31
255 0.33
256 0.33
257 0.34
258 0.33
259 0.37
260 0.4
261 0.37
262 0.32
263 0.31
264 0.28
265 0.27
266 0.26
267 0.21
268 0.16
269 0.11
270 0.09
271 0.07
272 0.04
273 0.05
274 0.05
275 0.04
276 0.05
277 0.05
278 0.06
279 0.08
280 0.09
281 0.08
282 0.1
283 0.1
284 0.12
285 0.14
286 0.15
287 0.18
288 0.18
289 0.2
290 0.26
291 0.29
292 0.29
293 0.3
294 0.34
295 0.3
296 0.31
297 0.31
298 0.25
299 0.21
300 0.19
301 0.17
302 0.12
303 0.12
304 0.11
305 0.12
306 0.12
307 0.12
308 0.14
309 0.13
310 0.13
311 0.13
312 0.13
313 0.13
314 0.13
315 0.13
316 0.13
317 0.16
318 0.15
319 0.15
320 0.22
321 0.29
322 0.35
323 0.42
324 0.45
325 0.51
326 0.55
327 0.56
328 0.54
329 0.51
330 0.5
331 0.51
332 0.5
333 0.44
334 0.41
335 0.44
336 0.42
337 0.37
338 0.33
339 0.26
340 0.26
341 0.23
342 0.23
343 0.2
344 0.2
345 0.22
346 0.2
347 0.2
348 0.17
349 0.18
350 0.2
351 0.19
352 0.19
353 0.2
354 0.2
355 0.21
356 0.22
357 0.22
358 0.21
359 0.24
360 0.23
361 0.25
362 0.27
363 0.3