Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6QHL5

Protein Details
Accession B6QHL5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
85-116KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tmf:PMAA_094660  -  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MSPLRSALSTASRSLLSVRQFAVTSFRQNNHVSSPFSQLRKFSGLLTQSRWGGLLRSKIANNAKQLSSTYIFSQASGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.21
4 0.21
5 0.21
6 0.21
7 0.21
8 0.21
9 0.25
10 0.22
11 0.27
12 0.29
13 0.3
14 0.33
15 0.34
16 0.36
17 0.36
18 0.37
19 0.32
20 0.3
21 0.36
22 0.36
23 0.37
24 0.37
25 0.32
26 0.32
27 0.31
28 0.3
29 0.23
30 0.23
31 0.24
32 0.24
33 0.26
34 0.26
35 0.23
36 0.22
37 0.22
38 0.17
39 0.14
40 0.15
41 0.15
42 0.15
43 0.17
44 0.17
45 0.22
46 0.26
47 0.28
48 0.29
49 0.28
50 0.27
51 0.25
52 0.26
53 0.24
54 0.21
55 0.19
56 0.16
57 0.18
58 0.17
59 0.17
60 0.18
61 0.16
62 0.17
63 0.19
64 0.19
65 0.15
66 0.17
67 0.23
68 0.26
69 0.3
70 0.32
71 0.32
72 0.4
73 0.44
74 0.46
75 0.48
76 0.51
77 0.55
78 0.6
79 0.65
80 0.66
81 0.73
82 0.78
83 0.77
84 0.79
85 0.81
86 0.79
87 0.78
88 0.78
89 0.76
90 0.77
91 0.79
92 0.75
93 0.75
94 0.77
95 0.81
96 0.82