Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067P945

Protein Details
Accession A0A067P945   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSSVPASQARKNKKVKKLLVEGVPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000195  Rab-GAP-TBC_dom  
IPR035969  Rab-GAP_TBC_sf  
Pfam View protein in Pfam  
PF00566  RabGAP-TBC  
PROSITE View protein in PROSITE  
PS50086  TBC_RABGAP  
Amino Acid Sequences MSSVPASQARKNKKVKKLLVEGVPSSVRYLVRIHLTDGKAKNVPKVYEQLVKRGHVPSYKEIERDVQAYIRENSQPPTMRESMMSLLEAYLTMVPDVQYSRGLTLIVGNIPLLAPEEDRFWTFVFPDGLVSSALFLLEQFTDGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.83
4 0.83
5 0.81
6 0.77
7 0.73
8 0.64
9 0.57
10 0.5
11 0.4
12 0.32
13 0.27
14 0.2
15 0.16
16 0.17
17 0.16
18 0.2
19 0.21
20 0.23
21 0.27
22 0.29
23 0.34
24 0.35
25 0.36
26 0.35
27 0.35
28 0.37
29 0.35
30 0.35
31 0.3
32 0.33
33 0.32
34 0.35
35 0.35
36 0.37
37 0.36
38 0.35
39 0.36
40 0.34
41 0.32
42 0.29
43 0.32
44 0.29
45 0.33
46 0.34
47 0.31
48 0.3
49 0.3
50 0.27
51 0.24
52 0.2
53 0.15
54 0.14
55 0.16
56 0.16
57 0.15
58 0.15
59 0.15
60 0.16
61 0.18
62 0.21
63 0.19
64 0.24
65 0.24
66 0.22
67 0.22
68 0.22
69 0.19
70 0.16
71 0.15
72 0.09
73 0.08
74 0.08
75 0.07
76 0.06
77 0.05
78 0.04
79 0.04
80 0.04
81 0.05
82 0.06
83 0.06
84 0.07
85 0.08
86 0.08
87 0.09
88 0.09
89 0.09
90 0.08
91 0.09
92 0.09
93 0.08
94 0.08
95 0.07
96 0.07
97 0.07
98 0.07
99 0.07
100 0.06
101 0.07
102 0.08
103 0.1
104 0.12
105 0.13
106 0.14
107 0.13
108 0.14
109 0.13
110 0.16
111 0.16
112 0.14
113 0.15
114 0.14
115 0.15
116 0.14
117 0.13
118 0.1
119 0.09
120 0.08
121 0.06
122 0.06
123 0.07
124 0.07