Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067NMU2

Protein Details
Accession A0A067NMU2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
63-82WEAAWRKSVRKPKLDRIDPTHydrophilic
NLS Segment(s)
PositionSequence
53-75RVARMRIPLRWEAAWRKSVRKPK
Subcellular Location(s) nucl 11, cyto 11, cyto_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR002156  RNaseH_domain  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0004523  F:RNA-DNA hybrid ribonuclease activity  
PROSITE View protein in PROSITE  
PS50879  RNASE_H_1  
Amino Acid Sequences LHWISAHDDVVGNERADVLAKEAATGVAHPAEHLPSLLTDHPRLPSSRAAVRRVARMRIPLRWEAAWRKSVRKPKLDRIDPTLKVGKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.13
5 0.11
6 0.1
7 0.1
8 0.1
9 0.1
10 0.11
11 0.1
12 0.09
13 0.08
14 0.07
15 0.07
16 0.07
17 0.07
18 0.08
19 0.08
20 0.07
21 0.06
22 0.06
23 0.08
24 0.1
25 0.12
26 0.12
27 0.13
28 0.15
29 0.16
30 0.16
31 0.16
32 0.17
33 0.19
34 0.24
35 0.27
36 0.28
37 0.33
38 0.35
39 0.41
40 0.41
41 0.41
42 0.37
43 0.42
44 0.42
45 0.41
46 0.43
47 0.38
48 0.38
49 0.35
50 0.39
51 0.38
52 0.4
53 0.42
54 0.41
55 0.45
56 0.5
57 0.59
58 0.62
59 0.64
60 0.68
61 0.71
62 0.79
63 0.81
64 0.78
65 0.77
66 0.78
67 0.7
68 0.68