Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067NES9

Protein Details
Accession A0A067NES9    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-22LTQNRKMWTRRNSKASWKTAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSLTQNRKMWTRRNSKASWKTAAHDRPPRITSQQTFLRRHCSLTESDTTTTYISLARLHVHEYLYNSCDLPRKILVQPVDQADDGVAIRIVGPGGTMTFEMFMNGQWTGGDYSRVERNLAKPRNKAVTFEAVLRADASLHIIEDSLSWPYPPAEASAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.79
3 0.81
4 0.78
5 0.76
6 0.68
7 0.63
8 0.65
9 0.67
10 0.65
11 0.64
12 0.62
13 0.61
14 0.6
15 0.6
16 0.55
17 0.54
18 0.48
19 0.46
20 0.51
21 0.52
22 0.56
23 0.54
24 0.57
25 0.5
26 0.5
27 0.44
28 0.38
29 0.31
30 0.3
31 0.32
32 0.28
33 0.28
34 0.26
35 0.26
36 0.23
37 0.2
38 0.16
39 0.12
40 0.09
41 0.09
42 0.09
43 0.1
44 0.1
45 0.12
46 0.13
47 0.13
48 0.13
49 0.15
50 0.16
51 0.16
52 0.16
53 0.14
54 0.14
55 0.18
56 0.16
57 0.16
58 0.16
59 0.18
60 0.18
61 0.22
62 0.23
63 0.2
64 0.22
65 0.21
66 0.21
67 0.18
68 0.17
69 0.12
70 0.11
71 0.09
72 0.07
73 0.05
74 0.03
75 0.04
76 0.04
77 0.04
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.04
84 0.04
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.07
91 0.06
92 0.06
93 0.05
94 0.07
95 0.08
96 0.08
97 0.1
98 0.09
99 0.12
100 0.16
101 0.17
102 0.18
103 0.19
104 0.26
105 0.35
106 0.43
107 0.48
108 0.49
109 0.55
110 0.63
111 0.61
112 0.57
113 0.51
114 0.5
115 0.44
116 0.42
117 0.4
118 0.3
119 0.3
120 0.27
121 0.22
122 0.14
123 0.13
124 0.13
125 0.09
126 0.08
127 0.08
128 0.08
129 0.08
130 0.08
131 0.09
132 0.1
133 0.1
134 0.09
135 0.11
136 0.11
137 0.12
138 0.12