Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067NXH0

Protein Details
Accession A0A067NXH0    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
53-77AKPPPAPRTHHKRKLNYLKLKRVVFHydrophilic
NLS Segment(s)
PositionSequence
52-88RAKPPPAPRTHHKRKLNYLKLKRVVFYKIKRFMKNRL
Subcellular Location(s) nucl 18.5, cyto_nucl 12.666, mito_nucl 11.499, cyto 4.5, cyto_mito 4.499
Family & Domain DBs
Amino Acid Sequences MGPEDFSMVEKDTSYSSNNLLSLGESWTFEENITIAILDAIGSRPNINAPQRAKPPPAPRTHHKRKLNYLKLKRVVFYKIKRFMKNRLLRSLLKVRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.17
5 0.17
6 0.16
7 0.15
8 0.13
9 0.12
10 0.12
11 0.11
12 0.1
13 0.11
14 0.12
15 0.12
16 0.11
17 0.1
18 0.08
19 0.08
20 0.07
21 0.06
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.05
30 0.05
31 0.05
32 0.07
33 0.11
34 0.12
35 0.18
36 0.2
37 0.26
38 0.31
39 0.35
40 0.37
41 0.4
42 0.47
43 0.49
44 0.55
45 0.55
46 0.58
47 0.66
48 0.73
49 0.76
50 0.76
51 0.76
52 0.79
53 0.84
54 0.86
55 0.86
56 0.85
57 0.85
58 0.84
59 0.79
60 0.7
61 0.62
62 0.59
63 0.58
64 0.58
65 0.58
66 0.6
67 0.66
68 0.72
69 0.73
70 0.75
71 0.77
72 0.77
73 0.75
74 0.74
75 0.72
76 0.67
77 0.7