Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067NTA9

Protein Details
Accession A0A067NTA9    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
57-80QVYEEKLKRRARKGWERSERYGRMBasic
NLS Segment(s)
PositionSequence
63-73LKRRARKGWER
Subcellular Location(s) cyto_nucl 12.5, nucl 12, cyto 11, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR002156  RNaseH_domain  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0004523  F:RNA-DNA hybrid ribonuclease activity  
Pfam View protein in Pfam  
PF00075  RNase_H  
PROSITE View protein in PROSITE  
PS50879  RNASE_H_1  
Amino Acid Sequences IKLIVHWIPGHEGVEGNERADKAVKEAAEGWVSKRSSLPAPLWEKDAIKRSTAAASQVYEEKLKRRARKGWERSERYGRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.17
4 0.18
5 0.17
6 0.17
7 0.19
8 0.18
9 0.14
10 0.17
11 0.16
12 0.15
13 0.16
14 0.17
15 0.17
16 0.17
17 0.16
18 0.19
19 0.19
20 0.18
21 0.18
22 0.18
23 0.17
24 0.2
25 0.19
26 0.2
27 0.25
28 0.25
29 0.27
30 0.27
31 0.26
32 0.27
33 0.33
34 0.27
35 0.23
36 0.23
37 0.22
38 0.23
39 0.23
40 0.21
41 0.16
42 0.15
43 0.16
44 0.18
45 0.18
46 0.19
47 0.2
48 0.22
49 0.29
50 0.37
51 0.43
52 0.49
53 0.56
54 0.64
55 0.73
56 0.79
57 0.82
58 0.84
59 0.84
60 0.85