Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067N8M1

Protein Details
Accession A0A067N8M1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
36-55SPSMDKKKKKTAPPVEAPVEHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 9, mito 5, extr 5, plas 3, cyto 2, pero 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFTVILQPTYQATSPSIAMRFALIVLAFAVVFVAASPSMDKKKKKTAPPVEAPVEETPAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.17
4 0.14
5 0.14
6 0.13
7 0.11
8 0.09
9 0.09
10 0.06
11 0.05
12 0.05
13 0.05
14 0.04
15 0.04
16 0.03
17 0.02
18 0.02
19 0.02
20 0.03
21 0.02
22 0.03
23 0.04
24 0.07
25 0.14
26 0.2
27 0.25
28 0.31
29 0.42
30 0.5
31 0.59
32 0.67
33 0.72
34 0.75
35 0.8
36 0.82
37 0.76
38 0.69
39 0.64
40 0.55