Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PAH0

Protein Details
Accession A0A067PAH0    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
284-306TFTTPRGRRREPRTSRSSRRSEAHydrophilic
NLS Segment(s)
PositionSequence
220-222PKR
289-305RGRRREPRTSRSSRRSE
Subcellular Location(s) nucl 18, cyto 8
Family & Domain DBs
Amino Acid Sequences MFEDVCLLCGKHLLDDGRAYCSDECQSLDSVSPSISSASSAVSSPYLSGNPLCGDIPALVPSALGSAFGDYPHYSASSSASTTWSVAADEDDFAGIKLDGEYLHKGDPRLGDGPSKSATYFPAFVRTSVMTYARRPSGTNQHANVPILHRRTSSVSTTEHMQGAPRSAPLHSRSNGSSTDEEDYSSDIQYTTADSPSLAPASKGWKRNKDPDSKSTLTKPKRNRNRASLPACFSLLHINGETRPSVSSPRTAARPSPPTPKLPLSSLTTTAIRMTPEVPPTAHTFTTPRGRRREPRTSRSSRRSEASLSRSASRSRSRNLSHPRVDSKGSVTQVFDLSSMLVPRGRTAARRNSSPPSKMVLPVPSDGQCRSSEPFATSRARSGRSDSRRSRGRARLEELDGNGSTEAAPGYGYGRSGLIDRERTFIHRTVAEYC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.27
3 0.28
4 0.3
5 0.3
6 0.31
7 0.27
8 0.28
9 0.27
10 0.23
11 0.23
12 0.2
13 0.22
14 0.19
15 0.21
16 0.19
17 0.18
18 0.16
19 0.15
20 0.13
21 0.12
22 0.11
23 0.11
24 0.1
25 0.1
26 0.11
27 0.1
28 0.11
29 0.11
30 0.11
31 0.11
32 0.12
33 0.12
34 0.12
35 0.13
36 0.14
37 0.14
38 0.15
39 0.14
40 0.12
41 0.13
42 0.12
43 0.13
44 0.11
45 0.11
46 0.1
47 0.09
48 0.09
49 0.09
50 0.08
51 0.07
52 0.06
53 0.07
54 0.08
55 0.08
56 0.11
57 0.1
58 0.11
59 0.11
60 0.12
61 0.1
62 0.11
63 0.13
64 0.12
65 0.13
66 0.13
67 0.14
68 0.14
69 0.15
70 0.15
71 0.12
72 0.11
73 0.1
74 0.1
75 0.09
76 0.09
77 0.09
78 0.08
79 0.08
80 0.07
81 0.08
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.09
88 0.12
89 0.12
90 0.15
91 0.17
92 0.17
93 0.2
94 0.21
95 0.22
96 0.22
97 0.22
98 0.24
99 0.22
100 0.25
101 0.24
102 0.24
103 0.2
104 0.18
105 0.2
106 0.18
107 0.2
108 0.17
109 0.24
110 0.24
111 0.23
112 0.26
113 0.24
114 0.22
115 0.21
116 0.25
117 0.19
118 0.21
119 0.26
120 0.26
121 0.26
122 0.26
123 0.29
124 0.35
125 0.41
126 0.45
127 0.42
128 0.44
129 0.46
130 0.45
131 0.42
132 0.35
133 0.33
134 0.29
135 0.29
136 0.24
137 0.24
138 0.27
139 0.29
140 0.27
141 0.25
142 0.23
143 0.23
144 0.26
145 0.25
146 0.22
147 0.19
148 0.18
149 0.15
150 0.16
151 0.15
152 0.13
153 0.12
154 0.12
155 0.16
156 0.19
157 0.24
158 0.23
159 0.26
160 0.25
161 0.27
162 0.28
163 0.27
164 0.24
165 0.19
166 0.21
167 0.18
168 0.17
169 0.15
170 0.15
171 0.12
172 0.12
173 0.1
174 0.07
175 0.07
176 0.07
177 0.09
178 0.08
179 0.08
180 0.08
181 0.07
182 0.08
183 0.09
184 0.1
185 0.08
186 0.07
187 0.08
188 0.15
189 0.2
190 0.28
191 0.33
192 0.42
193 0.47
194 0.56
195 0.63
196 0.66
197 0.66
198 0.64
199 0.67
200 0.6
201 0.57
202 0.55
203 0.56
204 0.53
205 0.55
206 0.58
207 0.6
208 0.69
209 0.77
210 0.76
211 0.76
212 0.78
213 0.8
214 0.76
215 0.7
216 0.63
217 0.54
218 0.49
219 0.4
220 0.31
221 0.25
222 0.2
223 0.16
224 0.13
225 0.12
226 0.12
227 0.13
228 0.12
229 0.09
230 0.09
231 0.09
232 0.12
233 0.13
234 0.15
235 0.16
236 0.19
237 0.21
238 0.22
239 0.25
240 0.28
241 0.34
242 0.34
243 0.41
244 0.41
245 0.42
246 0.45
247 0.45
248 0.41
249 0.36
250 0.35
251 0.31
252 0.3
253 0.29
254 0.27
255 0.23
256 0.21
257 0.21
258 0.18
259 0.14
260 0.12
261 0.12
262 0.13
263 0.14
264 0.15
265 0.14
266 0.15
267 0.19
268 0.21
269 0.2
270 0.18
271 0.18
272 0.22
273 0.32
274 0.37
275 0.4
276 0.45
277 0.53
278 0.61
279 0.68
280 0.74
281 0.74
282 0.76
283 0.79
284 0.82
285 0.84
286 0.84
287 0.83
288 0.76
289 0.7
290 0.64
291 0.59
292 0.57
293 0.52
294 0.49
295 0.44
296 0.43
297 0.42
298 0.41
299 0.42
300 0.42
301 0.42
302 0.4
303 0.47
304 0.47
305 0.54
306 0.62
307 0.65
308 0.64
309 0.65
310 0.65
311 0.6
312 0.59
313 0.51
314 0.45
315 0.42
316 0.37
317 0.32
318 0.28
319 0.26
320 0.25
321 0.23
322 0.18
323 0.13
324 0.11
325 0.11
326 0.1
327 0.1
328 0.11
329 0.11
330 0.11
331 0.15
332 0.16
333 0.21
334 0.28
335 0.38
336 0.41
337 0.46
338 0.5
339 0.56
340 0.62
341 0.59
342 0.54
343 0.5
344 0.47
345 0.44
346 0.44
347 0.4
348 0.35
349 0.33
350 0.34
351 0.32
352 0.32
353 0.3
354 0.29
355 0.25
356 0.25
357 0.27
358 0.26
359 0.25
360 0.26
361 0.28
362 0.31
363 0.35
364 0.33
365 0.37
366 0.39
367 0.41
368 0.4
369 0.44
370 0.49
371 0.53
372 0.62
373 0.62
374 0.66
375 0.71
376 0.76
377 0.78
378 0.76
379 0.78
380 0.76
381 0.75
382 0.73
383 0.7
384 0.68
385 0.6
386 0.56
387 0.46
388 0.38
389 0.31
390 0.24
391 0.18
392 0.14
393 0.12
394 0.07
395 0.07
396 0.06
397 0.08
398 0.08
399 0.09
400 0.09
401 0.09
402 0.1
403 0.11
404 0.16
405 0.21
406 0.28
407 0.29
408 0.32
409 0.33
410 0.37
411 0.41
412 0.4
413 0.38
414 0.34