Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067NU65

Protein Details
Accession A0A067NU65    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-28SASTSTRKKHAKKALGTPDQHydrophilic
30-49DTPIREKKPKAKEKGKGMSGBasic
NLS Segment(s)
PositionSequence
15-49RKKHAKKALGTPDQPDTPIREKKPKAKEKGKGMSG
Subcellular Location(s) nucl 21, mito_nucl 12.833, cyto_nucl 12.333, mito 3.5
Family & Domain DBs
Amino Acid Sequences MVKGNPKSSASTSTRKKHAKKALGTPDQPDTPIREKKPKAKEKGKGMSGFSKESRAKMYIPPTKPALVQPDPLDSMGLAHRVPPELIVVLRSLSKKAEVTKSNGMRDGSRMKTCHSEVLTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.69
3 0.73
4 0.75
5 0.79
6 0.79
7 0.77
8 0.79
9 0.8
10 0.8
11 0.75
12 0.69
13 0.63
14 0.54
15 0.48
16 0.39
17 0.34
18 0.33
19 0.38
20 0.4
21 0.45
22 0.5
23 0.58
24 0.67
25 0.71
26 0.74
27 0.76
28 0.79
29 0.79
30 0.82
31 0.79
32 0.71
33 0.65
34 0.61
35 0.54
36 0.49
37 0.39
38 0.38
39 0.33
40 0.31
41 0.3
42 0.25
43 0.24
44 0.25
45 0.33
46 0.33
47 0.34
48 0.35
49 0.35
50 0.34
51 0.33
52 0.31
53 0.3
54 0.24
55 0.25
56 0.23
57 0.23
58 0.23
59 0.22
60 0.2
61 0.12
62 0.11
63 0.1
64 0.1
65 0.08
66 0.08
67 0.09
68 0.1
69 0.1
70 0.09
71 0.09
72 0.09
73 0.09
74 0.08
75 0.08
76 0.08
77 0.11
78 0.12
79 0.12
80 0.12
81 0.15
82 0.17
83 0.22
84 0.3
85 0.31
86 0.37
87 0.45
88 0.51
89 0.52
90 0.53
91 0.49
92 0.42
93 0.44
94 0.45
95 0.42
96 0.42
97 0.4
98 0.4
99 0.45
100 0.46
101 0.48