Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067NWD8

Protein Details
Accession A0A067NWD8   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
32-52PPPSQPPKHRRAKRTEDERISBasic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, mito_nucl 12.666, cyto_nucl 12.333, mito 4.5
Family & Domain DBs
Amino Acid Sequences MSVHSSHPPPSHTTHNLSSSSYTTLSNHTTHPPPSQPPKHRRAKRTEDERISYLHSDPYIIVFEAHRVLCALCRKWIRLRPNSTYCSIPWDKHRTSCFSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.45
4 0.42
5 0.4
6 0.33
7 0.3
8 0.25
9 0.21
10 0.17
11 0.19
12 0.21
13 0.2
14 0.2
15 0.22
16 0.24
17 0.26
18 0.28
19 0.29
20 0.32
21 0.41
22 0.49
23 0.54
24 0.6
25 0.67
26 0.74
27 0.78
28 0.79
29 0.79
30 0.79
31 0.79
32 0.8
33 0.8
34 0.75
35 0.7
36 0.63
37 0.54
38 0.46
39 0.37
40 0.28
41 0.2
42 0.14
43 0.12
44 0.1
45 0.1
46 0.09
47 0.08
48 0.08
49 0.07
50 0.08
51 0.1
52 0.1
53 0.09
54 0.09
55 0.09
56 0.13
57 0.19
58 0.19
59 0.23
60 0.26
61 0.3
62 0.39
63 0.47
64 0.52
65 0.56
66 0.62
67 0.65
68 0.7
69 0.7
70 0.64
71 0.59
72 0.5
73 0.49
74 0.45
75 0.4
76 0.41
77 0.46
78 0.47
79 0.52
80 0.57
81 0.56