Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067NL57

Protein Details
Accession A0A067NL57   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
50-75EPDTANQKANKRRKRVKTEAQVPIFIHydrophilic
NLS Segment(s)
PositionSequence
48-49KR
54-65ANQKANKRRKRV
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MISRRSPEPGGQSTNAHPVDKEEVDLLRQQLQLIQKRLDEIDKPRGVKREPDTANQKANKRRKRVKTEAQVPIFIPAEVIDLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.35
4 0.29
5 0.26
6 0.29
7 0.26
8 0.25
9 0.18
10 0.16
11 0.17
12 0.2
13 0.18
14 0.16
15 0.16
16 0.15
17 0.17
18 0.23
19 0.28
20 0.29
21 0.29
22 0.26
23 0.26
24 0.27
25 0.26
26 0.23
27 0.21
28 0.27
29 0.28
30 0.3
31 0.32
32 0.35
33 0.35
34 0.39
35 0.37
36 0.38
37 0.38
38 0.43
39 0.49
40 0.49
41 0.56
42 0.54
43 0.58
44 0.58
45 0.66
46 0.67
47 0.7
48 0.75
49 0.78
50 0.83
51 0.86
52 0.87
53 0.88
54 0.89
55 0.89
56 0.82
57 0.74
58 0.64
59 0.58
60 0.48
61 0.37
62 0.27
63 0.17