Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067NJV0

Protein Details
Accession A0A067NJV0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
162-181RDNQKRVRKAYENRYRRMRSBasic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12.833, cyto 4, cyto_nucl 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR046522  DUF6699  
Pfam View protein in Pfam  
PF20415  DUF6699  
Amino Acid Sequences MTRKVRFSDKATVHHIPAVPPLSHSPPSPASSGSLPTPPNLPYTLPGSTPYPFVLPPKPAAPLRHQLQLHAALAGPQPNVLYDCSYSPSHLSILNRHISPRFASESATYPPTTSMTISSPSLPWTLRVTPRHGVISVSDVLYAIYDGLRSGIYPQDFESMTRDNQKRVRKAYENRYRRMRSSTDALEKAVLEKANGVKRVDFLMGHTVFMGLAPTRNPIHWVLITSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.48
3 0.39
4 0.39
5 0.36
6 0.29
7 0.27
8 0.3
9 0.31
10 0.31
11 0.31
12 0.3
13 0.3
14 0.32
15 0.31
16 0.27
17 0.25
18 0.24
19 0.26
20 0.23
21 0.23
22 0.22
23 0.21
24 0.23
25 0.21
26 0.21
27 0.2
28 0.19
29 0.17
30 0.2
31 0.21
32 0.19
33 0.2
34 0.21
35 0.2
36 0.2
37 0.19
38 0.16
39 0.16
40 0.19
41 0.21
42 0.21
43 0.23
44 0.23
45 0.27
46 0.29
47 0.32
48 0.33
49 0.38
50 0.38
51 0.43
52 0.42
53 0.38
54 0.39
55 0.38
56 0.33
57 0.24
58 0.21
59 0.15
60 0.16
61 0.17
62 0.13
63 0.09
64 0.09
65 0.09
66 0.1
67 0.09
68 0.09
69 0.08
70 0.09
71 0.12
72 0.13
73 0.13
74 0.13
75 0.13
76 0.13
77 0.15
78 0.15
79 0.16
80 0.2
81 0.23
82 0.22
83 0.23
84 0.23
85 0.21
86 0.21
87 0.2
88 0.19
89 0.16
90 0.17
91 0.17
92 0.19
93 0.19
94 0.2
95 0.17
96 0.13
97 0.14
98 0.13
99 0.12
100 0.1
101 0.1
102 0.09
103 0.1
104 0.11
105 0.11
106 0.1
107 0.11
108 0.12
109 0.11
110 0.11
111 0.13
112 0.16
113 0.22
114 0.25
115 0.28
116 0.29
117 0.31
118 0.31
119 0.28
120 0.24
121 0.18
122 0.19
123 0.15
124 0.13
125 0.11
126 0.09
127 0.09
128 0.08
129 0.08
130 0.04
131 0.03
132 0.03
133 0.03
134 0.04
135 0.04
136 0.04
137 0.05
138 0.09
139 0.09
140 0.1
141 0.11
142 0.13
143 0.13
144 0.14
145 0.17
146 0.16
147 0.18
148 0.27
149 0.28
150 0.31
151 0.38
152 0.47
153 0.51
154 0.54
155 0.6
156 0.61
157 0.69
158 0.74
159 0.77
160 0.77
161 0.77
162 0.81
163 0.77
164 0.71
165 0.68
166 0.61
167 0.56
168 0.54
169 0.54
170 0.52
171 0.49
172 0.46
173 0.41
174 0.37
175 0.33
176 0.29
177 0.22
178 0.14
179 0.16
180 0.22
181 0.27
182 0.31
183 0.31
184 0.28
185 0.29
186 0.31
187 0.29
188 0.23
189 0.19
190 0.25
191 0.24
192 0.23
193 0.22
194 0.19
195 0.17
196 0.17
197 0.16
198 0.08
199 0.09
200 0.1
201 0.14
202 0.15
203 0.16
204 0.2
205 0.2
206 0.25
207 0.25