Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067NYE4

Protein Details
Accession A0A067NYE4   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
81-106YIAWRLLKKLKLRKKLPKVGTWWRNNHydrophilic
NLS Segment(s)
PositionSequence
88-98KKLKLRKKLPK
Subcellular Location(s) cyto 7.5, cyto_nucl 6.5, cysk 6, mito 5, plas 5, nucl 2.5
Family & Domain DBs
Amino Acid Sequences MIVLLGICSVISRLDFSGVDTSPGPKRIPFPSLTTSTDVNADLASTTTVIMTQTDTSIITQIVSSENSATLGSGVFMFAAYIAWRLLKKLKLRKKLPKVGTWWRNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.12
4 0.16
5 0.15
6 0.17
7 0.16
8 0.19
9 0.2
10 0.23
11 0.22
12 0.2
13 0.24
14 0.25
15 0.29
16 0.28
17 0.29
18 0.32
19 0.35
20 0.36
21 0.34
22 0.31
23 0.28
24 0.26
25 0.22
26 0.16
27 0.12
28 0.09
29 0.06
30 0.06
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.05
41 0.05
42 0.06
43 0.05
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.07
52 0.06
53 0.06
54 0.07
55 0.07
56 0.06
57 0.05
58 0.05
59 0.05
60 0.04
61 0.04
62 0.04
63 0.04
64 0.03
65 0.03
66 0.04
67 0.04
68 0.05
69 0.05
70 0.07
71 0.08
72 0.1
73 0.16
74 0.22
75 0.31
76 0.41
77 0.51
78 0.59
79 0.7
80 0.79
81 0.84
82 0.89
83 0.87
84 0.85
85 0.84
86 0.84