Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067N5H1

Protein Details
Accession A0A067N5H1    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
14-34AKKKHGQSWLQLKKRFRREALHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 10.5, nucl 8.5, pero 2, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR035959  RutC-like_sf  
IPR006175  YjgF/YER057c/UK114  
Pfam View protein in Pfam  
PF01042  Ribonuc_L-PSP  
CDD cd06154  YjgF_YER057c_UK114_like_6  
Amino Acid Sequences MTEGEALTEGYGHAKKKHGQSWLQLKKRFRREALWGSSLYFFAEVIVKDIFESPVRLSLNNRRQHIYEHMERFTTSNPYEAAFGYSRAIRRGPHVFVSGTTSIDPTTGAVLFPDSAYLQTQQIFKEIIRALEGLGTSKEDVVRLRIFVTEQSDAGEVGRAMKEAFGDVGPAATMIVGAQFVRAEMKVEIEADAITL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.32
3 0.4
4 0.46
5 0.49
6 0.52
7 0.59
8 0.67
9 0.72
10 0.74
11 0.72
12 0.75
13 0.77
14 0.82
15 0.8
16 0.73
17 0.69
18 0.69
19 0.73
20 0.71
21 0.65
22 0.55
23 0.48
24 0.45
25 0.39
26 0.3
27 0.2
28 0.12
29 0.09
30 0.11
31 0.09
32 0.1
33 0.1
34 0.09
35 0.1
36 0.11
37 0.11
38 0.1
39 0.11
40 0.1
41 0.15
42 0.16
43 0.16
44 0.2
45 0.29
46 0.38
47 0.43
48 0.44
49 0.41
50 0.42
51 0.44
52 0.47
53 0.44
54 0.43
55 0.41
56 0.39
57 0.37
58 0.37
59 0.34
60 0.29
61 0.26
62 0.19
63 0.16
64 0.15
65 0.15
66 0.15
67 0.14
68 0.16
69 0.11
70 0.11
71 0.11
72 0.12
73 0.13
74 0.13
75 0.15
76 0.12
77 0.16
78 0.2
79 0.2
80 0.21
81 0.21
82 0.2
83 0.19
84 0.23
85 0.19
86 0.16
87 0.14
88 0.12
89 0.1
90 0.1
91 0.09
92 0.05
93 0.05
94 0.05
95 0.05
96 0.04
97 0.05
98 0.05
99 0.05
100 0.05
101 0.04
102 0.05
103 0.06
104 0.07
105 0.08
106 0.1
107 0.12
108 0.11
109 0.13
110 0.13
111 0.12
112 0.17
113 0.17
114 0.15
115 0.15
116 0.15
117 0.13
118 0.14
119 0.14
120 0.09
121 0.08
122 0.09
123 0.08
124 0.09
125 0.09
126 0.09
127 0.1
128 0.13
129 0.14
130 0.13
131 0.14
132 0.14
133 0.14
134 0.15
135 0.19
136 0.16
137 0.15
138 0.16
139 0.15
140 0.15
141 0.14
142 0.13
143 0.09
144 0.1
145 0.1
146 0.09
147 0.08
148 0.09
149 0.09
150 0.08
151 0.09
152 0.07
153 0.08
154 0.07
155 0.08
156 0.07
157 0.07
158 0.06
159 0.04
160 0.04
161 0.03
162 0.04
163 0.04
164 0.04
165 0.05
166 0.05
167 0.06
168 0.08
169 0.08
170 0.1
171 0.1
172 0.13
173 0.13
174 0.14
175 0.14
176 0.13