Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6Q5X6

Protein Details
Accession B6Q5X6    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
131-156TENDSKRQKTEQKKPGRKPRRSTPISHydrophilic
NLS Segment(s)
PositionSequence
137-151RQKTEQKKPGRKPRR
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 5, cyto 3
Family & Domain DBs
KEGG tmf:PMAA_033220  -  
Amino Acid Sequences MTVSQVTKYHIHPVTKLPTRRTEIKSEDGTGQKLYYYDPVCDFCKAKKIACHHRDIYDEFGRLVKRGETPPKLDGPKPASGQAKKAAFKIQIKTFGNGSEKSSETSTASQRPRRANAGKRMLDDVSIESATENDSKRQKTEQKKPGRKPRRSTPISIEDTEAEPLSASSPATEPSVTPLVTQQLRGGNLDNSMDLAWYRGMTSLLEKRINDTTQKWKVLKQTIDQAEEQWEEVQQSMQSTKNFMNEWTSRFARSDAFTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.6
4 0.56
5 0.59
6 0.63
7 0.7
8 0.67
9 0.66
10 0.63
11 0.64
12 0.61
13 0.56
14 0.55
15 0.49
16 0.46
17 0.39
18 0.33
19 0.26
20 0.22
21 0.21
22 0.21
23 0.19
24 0.2
25 0.21
26 0.25
27 0.26
28 0.29
29 0.29
30 0.25
31 0.32
32 0.33
33 0.34
34 0.37
35 0.45
36 0.52
37 0.57
38 0.63
39 0.57
40 0.59
41 0.59
42 0.55
43 0.53
44 0.46
45 0.4
46 0.32
47 0.32
48 0.29
49 0.25
50 0.24
51 0.18
52 0.19
53 0.25
54 0.33
55 0.35
56 0.38
57 0.41
58 0.47
59 0.48
60 0.46
61 0.46
62 0.42
63 0.43
64 0.41
65 0.43
66 0.43
67 0.41
68 0.43
69 0.43
70 0.44
71 0.4
72 0.4
73 0.39
74 0.38
75 0.41
76 0.44
77 0.41
78 0.44
79 0.44
80 0.44
81 0.39
82 0.37
83 0.35
84 0.3
85 0.28
86 0.22
87 0.21
88 0.21
89 0.21
90 0.18
91 0.16
92 0.18
93 0.19
94 0.24
95 0.3
96 0.33
97 0.39
98 0.42
99 0.43
100 0.48
101 0.53
102 0.54
103 0.57
104 0.62
105 0.58
106 0.55
107 0.54
108 0.46
109 0.39
110 0.31
111 0.22
112 0.14
113 0.11
114 0.1
115 0.07
116 0.07
117 0.07
118 0.09
119 0.09
120 0.12
121 0.17
122 0.18
123 0.19
124 0.26
125 0.34
126 0.41
127 0.51
128 0.57
129 0.64
130 0.73
131 0.81
132 0.86
133 0.89
134 0.88
135 0.85
136 0.86
137 0.85
138 0.79
139 0.74
140 0.7
141 0.68
142 0.64
143 0.57
144 0.47
145 0.38
146 0.35
147 0.31
148 0.23
149 0.13
150 0.09
151 0.08
152 0.07
153 0.07
154 0.05
155 0.05
156 0.06
157 0.07
158 0.08
159 0.08
160 0.07
161 0.11
162 0.14
163 0.13
164 0.13
165 0.13
166 0.17
167 0.18
168 0.19
169 0.18
170 0.19
171 0.2
172 0.21
173 0.21
174 0.17
175 0.17
176 0.17
177 0.14
178 0.11
179 0.1
180 0.09
181 0.07
182 0.08
183 0.07
184 0.06
185 0.07
186 0.07
187 0.07
188 0.08
189 0.13
190 0.18
191 0.23
192 0.27
193 0.27
194 0.3
195 0.35
196 0.37
197 0.36
198 0.35
199 0.4
200 0.44
201 0.52
202 0.5
203 0.49
204 0.55
205 0.6
206 0.59
207 0.54
208 0.56
209 0.54
210 0.56
211 0.53
212 0.45
213 0.41
214 0.37
215 0.33
216 0.24
217 0.18
218 0.15
219 0.15
220 0.15
221 0.11
222 0.13
223 0.15
224 0.19
225 0.19
226 0.22
227 0.24
228 0.27
229 0.27
230 0.26
231 0.32
232 0.31
233 0.34
234 0.38
235 0.37
236 0.35
237 0.35
238 0.36
239 0.32