Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067NR69

Protein Details
Accession A0A067NR69    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
57-83MRIPIRWEKAWRKSARKPKLDRIDPTLHydrophilic
NLS Segment(s)
PositionSequence
51-76IRRVARMRIPIRWEKAWRKSARKPKL
Subcellular Location(s) pero 8, cyto 7.5, cyto_nucl 7.5, nucl 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR002156  RNaseH_domain  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0004523  F:RNA-DNA hybrid ribonuclease activity  
PROSITE View protein in PROSITE  
PS50879  RNASE_H_1  
Amino Acid Sequences LHWISAHDNVIGNDRADVLAKEAATGTAQPAEHCPSLFTNYPMLPASRAAIRRVARMRIPIRWEKAWRKSARKPKLDRIDPTLKVGKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.14
4 0.13
5 0.11
6 0.12
7 0.11
8 0.11
9 0.11
10 0.11
11 0.1
12 0.1
13 0.08
14 0.09
15 0.09
16 0.09
17 0.12
18 0.15
19 0.15
20 0.15
21 0.15
22 0.14
23 0.18
24 0.18
25 0.17
26 0.16
27 0.15
28 0.17
29 0.16
30 0.15
31 0.12
32 0.11
33 0.11
34 0.12
35 0.13
36 0.13
37 0.19
38 0.2
39 0.26
40 0.29
41 0.31
42 0.3
43 0.37
44 0.39
45 0.38
46 0.43
47 0.44
48 0.46
49 0.48
50 0.55
51 0.56
52 0.62
53 0.66
54 0.68
55 0.7
56 0.75
57 0.8
58 0.82
59 0.83
60 0.82
61 0.84
62 0.86
63 0.86
64 0.81
65 0.79
66 0.78
67 0.7
68 0.68