Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067NTY6

Protein Details
Accession A0A067NTY6    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-47SSSSSKAPSKPSKSKSKSKGPPRVYTDAHydrophilic
NLS Segment(s)
PositionSequence
26-40APSKPSKSKSKSKGP
Subcellular Location(s) nucl 14, cyto_nucl 12.833, mito_nucl 8.999, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015947  PUA-like_sf  
Amino Acid Sequences MPPERTEKLVQRTLDGKVASSSSSKAPSKPSKSKSKSKGPPRVYTDAILTIQPKFADLILKKEKNHEFRKYHLREGVVRLWLYETAPTSALTYIIETGPPKEPGEVQDSTGIGNDDFDAGKKESKFGYPVLGLLRLPKALTVNDMEKFGLATPQGYYYATQSLVDGQPLDSMERVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.37
3 0.3
4 0.25
5 0.25
6 0.22
7 0.2
8 0.19
9 0.17
10 0.24
11 0.25
12 0.26
13 0.34
14 0.43
15 0.51
16 0.59
17 0.63
18 0.68
19 0.73
20 0.81
21 0.81
22 0.82
23 0.82
24 0.83
25 0.86
26 0.82
27 0.84
28 0.81
29 0.78
30 0.69
31 0.6
32 0.51
33 0.43
34 0.37
35 0.29
36 0.23
37 0.17
38 0.16
39 0.15
40 0.13
41 0.1
42 0.1
43 0.16
44 0.15
45 0.23
46 0.31
47 0.35
48 0.35
49 0.43
50 0.49
51 0.51
52 0.58
53 0.6
54 0.53
55 0.56
56 0.66
57 0.62
58 0.6
59 0.54
60 0.49
61 0.43
62 0.44
63 0.42
64 0.34
65 0.29
66 0.24
67 0.22
68 0.2
69 0.17
70 0.13
71 0.1
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.08
78 0.07
79 0.06
80 0.06
81 0.06
82 0.06
83 0.06
84 0.08
85 0.1
86 0.11
87 0.11
88 0.11
89 0.12
90 0.13
91 0.18
92 0.17
93 0.16
94 0.16
95 0.16
96 0.16
97 0.16
98 0.14
99 0.09
100 0.08
101 0.07
102 0.06
103 0.06
104 0.06
105 0.09
106 0.1
107 0.14
108 0.14
109 0.16
110 0.16
111 0.18
112 0.2
113 0.17
114 0.2
115 0.17
116 0.18
117 0.18
118 0.18
119 0.16
120 0.17
121 0.18
122 0.14
123 0.14
124 0.13
125 0.14
126 0.13
127 0.15
128 0.17
129 0.19
130 0.2
131 0.21
132 0.2
133 0.18
134 0.18
135 0.16
136 0.14
137 0.1
138 0.1
139 0.1
140 0.12
141 0.13
142 0.13
143 0.13
144 0.13
145 0.15
146 0.15
147 0.15
148 0.13
149 0.17
150 0.17
151 0.17
152 0.16
153 0.14
154 0.15
155 0.16
156 0.17