Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067NTP4

Protein Details
Accession A0A067NTP4   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20TKKRRNGGRNKKGRGHVNFLBasic
83-113VRVRSREGRRNRAPPPRVRWKDGKKVNPAVAHydrophilic
NLS Segment(s)
PositionSequence
2-14KKRRNGGRNKKGR
86-107RSREGRRNRAPPPRVRWKDGKK
Subcellular Location(s) mito 15, nucl 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences TKKRRNGGRNKKGRGHVNFLRCSNCSRAIAKDKAIKRFTVRNMVESAAVRDISEASAYAQYTLPKLYIKIVYCVSCAIHSHVVRVRSREGRRNRAPPPRVRWKDGKKVNPAVAAAEDAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.76
4 0.74
5 0.71
6 0.66
7 0.62
8 0.53
9 0.5
10 0.46
11 0.42
12 0.37
13 0.33
14 0.37
15 0.41
16 0.43
17 0.45
18 0.48
19 0.49
20 0.54
21 0.54
22 0.49
23 0.45
24 0.49
25 0.48
26 0.5
27 0.46
28 0.39
29 0.39
30 0.37
31 0.34
32 0.27
33 0.24
34 0.15
35 0.14
36 0.11
37 0.1
38 0.09
39 0.08
40 0.07
41 0.06
42 0.05
43 0.06
44 0.06
45 0.07
46 0.08
47 0.08
48 0.08
49 0.09
50 0.08
51 0.08
52 0.08
53 0.1
54 0.13
55 0.13
56 0.16
57 0.18
58 0.17
59 0.18
60 0.18
61 0.16
62 0.13
63 0.13
64 0.14
65 0.19
66 0.18
67 0.21
68 0.24
69 0.29
70 0.3
71 0.32
72 0.35
73 0.37
74 0.44
75 0.49
76 0.56
77 0.61
78 0.68
79 0.73
80 0.76
81 0.78
82 0.8
83 0.8
84 0.8
85 0.81
86 0.79
87 0.77
88 0.79
89 0.78
90 0.8
91 0.81
92 0.8
93 0.79
94 0.81
95 0.79
96 0.72
97 0.63
98 0.55
99 0.46