Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6QIW5

Protein Details
Accession B6QIW5    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
189-210EADRRRRYTRPTRKVSCPFRFQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR004330  FAR1_DNA_bnd_dom  
IPR010061  MeMal-semiAld_DH  
Gene Ontology GO:0004491  F:methylmalonate-semialdehyde dehydrogenase (acylating) activity  
KEGG tmf:PMAA_099000  -  
Pfam View protein in Pfam  
PF03101  FAR1  
Amino Acid Sequences MADFRSCIFKWALDPAPGPSMQTSDSTSFDFRPYLNKPSFRNKTDTPIFRNSKASAKIAEAQNALQGQFRPTQNTTRKQLRPAGEASDSDSLCSDSEDDYTNPFSNSAMPTISDDEPQTRGSLPSMTMYPMQMGYRDVADEINRWLAKHKQGYGIVIQRSNKTALGYVRSVTLGCDRGGAYKNSHQVTEADRRRRYTRPTRKVSCPFRFQIKPGDEGSWKATMVSDVHNHPLSEDAAEHAKQRQLFLSPEIKNEIITMFNSKVPARKVLAELEKKYGDIPIRRKDLYNFKRTARIKSQLNGSASRSPGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.34
4 0.32
5 0.31
6 0.24
7 0.22
8 0.19
9 0.2
10 0.21
11 0.19
12 0.21
13 0.23
14 0.24
15 0.23
16 0.24
17 0.23
18 0.2
19 0.25
20 0.28
21 0.34
22 0.39
23 0.44
24 0.47
25 0.57
26 0.65
27 0.62
28 0.65
29 0.59
30 0.61
31 0.64
32 0.66
33 0.62
34 0.63
35 0.64
36 0.6
37 0.62
38 0.55
39 0.53
40 0.5
41 0.46
42 0.37
43 0.36
44 0.4
45 0.37
46 0.39
47 0.32
48 0.28
49 0.29
50 0.28
51 0.25
52 0.2
53 0.18
54 0.17
55 0.22
56 0.23
57 0.25
58 0.26
59 0.36
60 0.42
61 0.49
62 0.54
63 0.58
64 0.61
65 0.62
66 0.67
67 0.61
68 0.57
69 0.52
70 0.48
71 0.4
72 0.36
73 0.34
74 0.31
75 0.27
76 0.23
77 0.2
78 0.17
79 0.14
80 0.14
81 0.12
82 0.07
83 0.08
84 0.1
85 0.1
86 0.12
87 0.14
88 0.15
89 0.14
90 0.14
91 0.13
92 0.13
93 0.14
94 0.13
95 0.1
96 0.1
97 0.11
98 0.15
99 0.15
100 0.14
101 0.14
102 0.14
103 0.16
104 0.16
105 0.15
106 0.12
107 0.12
108 0.11
109 0.12
110 0.1
111 0.1
112 0.1
113 0.11
114 0.11
115 0.1
116 0.1
117 0.1
118 0.09
119 0.09
120 0.09
121 0.08
122 0.08
123 0.07
124 0.07
125 0.07
126 0.07
127 0.08
128 0.08
129 0.11
130 0.11
131 0.11
132 0.14
133 0.17
134 0.22
135 0.25
136 0.26
137 0.27
138 0.28
139 0.29
140 0.31
141 0.32
142 0.28
143 0.27
144 0.26
145 0.22
146 0.23
147 0.23
148 0.19
149 0.15
150 0.16
151 0.14
152 0.16
153 0.16
154 0.15
155 0.14
156 0.14
157 0.13
158 0.11
159 0.13
160 0.11
161 0.1
162 0.11
163 0.1
164 0.13
165 0.15
166 0.16
167 0.17
168 0.2
169 0.26
170 0.25
171 0.25
172 0.23
173 0.23
174 0.26
175 0.34
176 0.37
177 0.39
178 0.42
179 0.46
180 0.49
181 0.53
182 0.57
183 0.58
184 0.62
185 0.64
186 0.71
187 0.74
188 0.79
189 0.84
190 0.85
191 0.81
192 0.77
193 0.7
194 0.68
195 0.64
196 0.57
197 0.56
198 0.48
199 0.44
200 0.39
201 0.39
202 0.31
203 0.3
204 0.31
205 0.23
206 0.21
207 0.17
208 0.15
209 0.13
210 0.14
211 0.15
212 0.16
213 0.16
214 0.2
215 0.22
216 0.21
217 0.2
218 0.21
219 0.18
220 0.15
221 0.13
222 0.11
223 0.13
224 0.14
225 0.16
226 0.17
227 0.19
228 0.19
229 0.2
230 0.21
231 0.2
232 0.22
233 0.26
234 0.32
235 0.3
236 0.32
237 0.35
238 0.33
239 0.29
240 0.28
241 0.24
242 0.16
243 0.16
244 0.18
245 0.15
246 0.17
247 0.19
248 0.2
249 0.24
250 0.26
251 0.3
252 0.28
253 0.3
254 0.31
255 0.36
256 0.45
257 0.48
258 0.48
259 0.48
260 0.46
261 0.43
262 0.41
263 0.38
264 0.35
265 0.36
266 0.42
267 0.45
268 0.51
269 0.53
270 0.55
271 0.58
272 0.62
273 0.63
274 0.64
275 0.61
276 0.58
277 0.66
278 0.66
279 0.68
280 0.66
281 0.65
282 0.63
283 0.63
284 0.68
285 0.65
286 0.66
287 0.61
288 0.57
289 0.54