Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6Q803

Protein Details
Accession B6Q803   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MAAVIKRIFRRKNKAPLACSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 6, extr 3, cyto_nucl 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010634  DUF1223  
IPR036249  Thioredoxin-like_sf  
KEGG tmf:PMAA_016850  -  
Pfam View protein in Pfam  
PF06764  DUF1223  
Amino Acid Sequences MAAVIKRIFRRKNKAPLACSILMLDDADHVHTNACFLDVQPLAVVELFQSQGCKSCVVNVPKIHEAVQNPNVILLTYNVTHFDRAEWQDTFASKQWDSRQRAYVTKWGRNSIFTPQVIVDGTTDGTGETVDQVMDLVQRARQMRSQQNWNILLDSNDTELRIDTDLFETKPHDIILCYYEPKPQVVKIGKGVNKGKKLTHQNVVRMVSKIGEWRGGNLTITLPSLVEARDRGYSILGIVQEPSGGRILAAHSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.8
3 0.78
4 0.76
5 0.67
6 0.58
7 0.47
8 0.38
9 0.29
10 0.25
11 0.17
12 0.1
13 0.09
14 0.11
15 0.11
16 0.1
17 0.11
18 0.11
19 0.11
20 0.1
21 0.11
22 0.09
23 0.08
24 0.14
25 0.13
26 0.14
27 0.13
28 0.13
29 0.12
30 0.12
31 0.12
32 0.06
33 0.07
34 0.07
35 0.07
36 0.09
37 0.08
38 0.13
39 0.14
40 0.15
41 0.13
42 0.19
43 0.27
44 0.3
45 0.37
46 0.36
47 0.41
48 0.42
49 0.43
50 0.38
51 0.34
52 0.32
53 0.33
54 0.34
55 0.31
56 0.28
57 0.27
58 0.25
59 0.22
60 0.19
61 0.12
62 0.1
63 0.08
64 0.09
65 0.11
66 0.12
67 0.12
68 0.12
69 0.12
70 0.16
71 0.18
72 0.21
73 0.19
74 0.2
75 0.21
76 0.22
77 0.23
78 0.2
79 0.21
80 0.18
81 0.22
82 0.28
83 0.35
84 0.4
85 0.42
86 0.46
87 0.45
88 0.49
89 0.47
90 0.48
91 0.45
92 0.46
93 0.44
94 0.42
95 0.39
96 0.38
97 0.37
98 0.34
99 0.32
100 0.26
101 0.25
102 0.2
103 0.2
104 0.18
105 0.17
106 0.11
107 0.07
108 0.07
109 0.06
110 0.05
111 0.04
112 0.04
113 0.04
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.04
123 0.04
124 0.05
125 0.09
126 0.1
127 0.12
128 0.15
129 0.22
130 0.29
131 0.34
132 0.42
133 0.42
134 0.48
135 0.48
136 0.45
137 0.39
138 0.32
139 0.27
140 0.2
141 0.18
142 0.13
143 0.11
144 0.1
145 0.1
146 0.09
147 0.1
148 0.09
149 0.08
150 0.07
151 0.09
152 0.11
153 0.11
154 0.12
155 0.12
156 0.13
157 0.13
158 0.13
159 0.11
160 0.1
161 0.11
162 0.13
163 0.14
164 0.15
165 0.15
166 0.19
167 0.2
168 0.22
169 0.22
170 0.2
171 0.27
172 0.28
173 0.31
174 0.32
175 0.4
176 0.41
177 0.47
178 0.54
179 0.53
180 0.56
181 0.56
182 0.53
183 0.54
184 0.61
185 0.59
186 0.6
187 0.58
188 0.58
189 0.62
190 0.63
191 0.57
192 0.48
193 0.42
194 0.34
195 0.29
196 0.28
197 0.22
198 0.24
199 0.21
200 0.23
201 0.26
202 0.26
203 0.25
204 0.21
205 0.2
206 0.16
207 0.16
208 0.14
209 0.1
210 0.09
211 0.1
212 0.1
213 0.11
214 0.11
215 0.13
216 0.15
217 0.15
218 0.15
219 0.16
220 0.15
221 0.14
222 0.16
223 0.14
224 0.12
225 0.12
226 0.12
227 0.12
228 0.12
229 0.13
230 0.11
231 0.1
232 0.09
233 0.1