Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6Q2K2

Protein Details
Accession B6Q2K2    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
152-173NPFATDKTKKKKKNTNTNTPISHydrophilic
249-276DAAPMNFKKKKPNTPKKLGSNKPAPPSKHydrophilic
NLS Segment(s)
PositionSequence
162-162K
256-279KKKKPNTPKKLGSNKPAPPSKLKK
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013246  SAGA_su_Sgf11  
Gene Ontology GO:0005634  C:nucleus  
GO:0070461  C:SAGA-type complex  
GO:0046872  F:metal ion binding  
KEGG tmf:PMAA_018670  -  
Pfam View protein in Pfam  
PF08209  Sgf11  
Amino Acid Sequences MAGPDSNKTTETGSRVLTTASFSELSKDILNATFYNIIHDLVAKVHRDEKLARMRSAVVLARQKAEAEAEAGGVPEKKVQVETEGAICENGKVYLKGNPLATTKEIVCPFCRLPRLLYPTMGVGARPPPDPSKEYCTKHPLVSRPGYDVHGNPFATDKTKKKKKNTNTNTPISSPPSTPDTNGSSKQNAPDYPTIKCPNCPRYCQTNRVAAHLDRCMGISGRTATRNREGGSATPTTSGPPKRPFPDDDAAPMNFKKKKPNTPKKLGSNKPAPPSKLKKAATPDTMLAEEAAEAAEAAEAAESAESFHDPSVDGEEKVES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.26
4 0.23
5 0.21
6 0.17
7 0.17
8 0.16
9 0.14
10 0.17
11 0.18
12 0.19
13 0.17
14 0.17
15 0.15
16 0.16
17 0.19
18 0.15
19 0.18
20 0.2
21 0.19
22 0.23
23 0.22
24 0.2
25 0.18
26 0.18
27 0.16
28 0.14
29 0.19
30 0.16
31 0.18
32 0.22
33 0.24
34 0.27
35 0.28
36 0.34
37 0.41
38 0.45
39 0.43
40 0.4
41 0.4
42 0.38
43 0.4
44 0.34
45 0.3
46 0.32
47 0.33
48 0.32
49 0.31
50 0.3
51 0.26
52 0.25
53 0.18
54 0.13
55 0.11
56 0.1
57 0.09
58 0.09
59 0.1
60 0.09
61 0.09
62 0.09
63 0.1
64 0.1
65 0.11
66 0.11
67 0.13
68 0.15
69 0.16
70 0.15
71 0.15
72 0.15
73 0.14
74 0.13
75 0.11
76 0.09
77 0.09
78 0.08
79 0.08
80 0.1
81 0.15
82 0.17
83 0.2
84 0.21
85 0.22
86 0.23
87 0.25
88 0.25
89 0.21
90 0.2
91 0.22
92 0.24
93 0.23
94 0.22
95 0.24
96 0.25
97 0.27
98 0.29
99 0.25
100 0.26
101 0.32
102 0.38
103 0.35
104 0.34
105 0.3
106 0.28
107 0.28
108 0.24
109 0.17
110 0.11
111 0.12
112 0.13
113 0.13
114 0.14
115 0.15
116 0.19
117 0.21
118 0.23
119 0.28
120 0.34
121 0.37
122 0.4
123 0.44
124 0.43
125 0.45
126 0.46
127 0.44
128 0.43
129 0.44
130 0.4
131 0.35
132 0.34
133 0.32
134 0.29
135 0.24
136 0.21
137 0.21
138 0.2
139 0.17
140 0.17
141 0.16
142 0.18
143 0.22
144 0.25
145 0.31
146 0.41
147 0.49
148 0.57
149 0.66
150 0.73
151 0.8
152 0.83
153 0.83
154 0.82
155 0.8
156 0.73
157 0.65
158 0.57
159 0.5
160 0.42
161 0.31
162 0.25
163 0.24
164 0.22
165 0.21
166 0.22
167 0.22
168 0.24
169 0.26
170 0.26
171 0.25
172 0.26
173 0.28
174 0.28
175 0.24
176 0.25
177 0.28
178 0.28
179 0.27
180 0.32
181 0.35
182 0.33
183 0.37
184 0.4
185 0.45
186 0.47
187 0.5
188 0.49
189 0.53
190 0.58
191 0.61
192 0.58
193 0.56
194 0.53
195 0.52
196 0.51
197 0.42
198 0.4
199 0.34
200 0.3
201 0.21
202 0.21
203 0.18
204 0.14
205 0.13
206 0.12
207 0.13
208 0.15
209 0.2
210 0.22
211 0.25
212 0.3
213 0.33
214 0.31
215 0.31
216 0.29
217 0.26
218 0.29
219 0.27
220 0.22
221 0.2
222 0.19
223 0.18
224 0.23
225 0.25
226 0.28
227 0.33
228 0.39
229 0.42
230 0.46
231 0.48
232 0.49
233 0.52
234 0.47
235 0.44
236 0.42
237 0.39
238 0.37
239 0.34
240 0.35
241 0.34
242 0.35
243 0.41
244 0.46
245 0.56
246 0.64
247 0.75
248 0.77
249 0.82
250 0.9
251 0.9
252 0.92
253 0.89
254 0.87
255 0.85
256 0.82
257 0.8
258 0.78
259 0.71
260 0.71
261 0.71
262 0.71
263 0.71
264 0.66
265 0.64
266 0.65
267 0.69
268 0.65
269 0.6
270 0.53
271 0.46
272 0.45
273 0.39
274 0.3
275 0.21
276 0.16
277 0.12
278 0.09
279 0.05
280 0.04
281 0.04
282 0.04
283 0.04
284 0.04
285 0.03
286 0.03
287 0.04
288 0.04
289 0.04
290 0.05
291 0.06
292 0.07
293 0.08
294 0.08
295 0.08
296 0.09
297 0.1
298 0.17
299 0.18
300 0.18