Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A063BU05

Protein Details
Accession A0A063BU05    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPKVAKGRGKRTDDGKKKRGPKRGLSAYMBasic
NLS Segment(s)
PositionSequence
5-23AKGRGKRTDDGKKKRGPKR
Subcellular Location(s) nucl 15, cyto 7, mito 4, cyto_pero 4
Family & Domain DBs
Amino Acid Sequences MPKVAKGRGKRTDDGKKKRGPKRGLSAYMFFANEQRENVRSENPNITFGQVGKVLGERWKALSHTQRAPYEAKAAADKKRYEDEKAAWQAEDESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.79
4 0.82
5 0.84
6 0.85
7 0.82
8 0.8
9 0.8
10 0.8
11 0.79
12 0.73
13 0.67
14 0.6
15 0.54
16 0.45
17 0.34
18 0.27
19 0.22
20 0.19
21 0.18
22 0.17
23 0.16
24 0.18
25 0.19
26 0.22
27 0.21
28 0.23
29 0.28
30 0.27
31 0.28
32 0.26
33 0.25
34 0.2
35 0.18
36 0.17
37 0.11
38 0.1
39 0.08
40 0.08
41 0.08
42 0.11
43 0.12
44 0.11
45 0.12
46 0.13
47 0.14
48 0.2
49 0.27
50 0.3
51 0.35
52 0.41
53 0.41
54 0.42
55 0.43
56 0.39
57 0.35
58 0.31
59 0.26
60 0.27
61 0.3
62 0.33
63 0.38
64 0.38
65 0.38
66 0.45
67 0.47
68 0.46
69 0.48
70 0.46
71 0.49
72 0.55
73 0.52
74 0.43
75 0.41