Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7HXZ7

Protein Details
Accession W7HXZ7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
41-62LTLVCKKCKKAFRKDSREFEEAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto_mito 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008913  Znf_CHY  
IPR037274  Znf_CHY_sf  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05495  zf-CHY  
PROSITE View protein in PROSITE  
PS51266  ZF_CHY  
Amino Acid Sequences MCKHILNAQVSIRSPCCRKWFDCPDCHAESENHALLKVAELTLVCKKCKKAFRKDSREFEEADEYCPHCDNHYVLKAKTPQAVLKVESEDVRMDNRWVSRSTCFLFLVAAAGDITSWC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.43
4 0.44
5 0.46
6 0.52
7 0.59
8 0.62
9 0.66
10 0.65
11 0.64
12 0.61
13 0.59
14 0.51
15 0.4
16 0.35
17 0.34
18 0.3
19 0.23
20 0.2
21 0.19
22 0.16
23 0.16
24 0.13
25 0.08
26 0.06
27 0.06
28 0.09
29 0.15
30 0.18
31 0.18
32 0.21
33 0.24
34 0.31
35 0.4
36 0.46
37 0.5
38 0.59
39 0.69
40 0.76
41 0.82
42 0.83
43 0.81
44 0.74
45 0.64
46 0.54
47 0.5
48 0.39
49 0.33
50 0.26
51 0.2
52 0.2
53 0.2
54 0.18
55 0.12
56 0.14
57 0.13
58 0.16
59 0.22
60 0.25
61 0.24
62 0.3
63 0.34
64 0.34
65 0.36
66 0.33
67 0.28
68 0.29
69 0.32
70 0.27
71 0.25
72 0.25
73 0.23
74 0.21
75 0.2
76 0.17
77 0.15
78 0.16
79 0.15
80 0.14
81 0.17
82 0.19
83 0.2
84 0.21
85 0.23
86 0.24
87 0.29
88 0.3
89 0.3
90 0.28
91 0.25
92 0.23
93 0.2
94 0.19
95 0.13
96 0.11
97 0.08
98 0.07