Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6QK13

Protein Details
Accession B6QK13    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
331-352GEYYLWRTRKQKWSWKVGENGDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto 8, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR026992  DIOX_N  
IPR044861  IPNS-like_FE2OG_OXY  
IPR027443  IPNS-like_sf  
IPR005123  Oxoglu/Fe-dep_dioxygenase  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0016491  F:oxidoreductase activity  
GO:0044249  P:cellular biosynthetic process  
GO:1901362  P:organic cyclic compound biosynthetic process  
GO:0044283  P:small molecule biosynthetic process  
KEGG tmf:PMAA_091740  -  
Pfam View protein in Pfam  
PF03171  2OG-FeII_Oxy  
PF14226  DIOX_N  
PROSITE View protein in PROSITE  
PS51471  FE2OG_OXY  
Amino Acid Sequences MSTTVTSTNNTPKTIRLTNGKDFTFVSNAATTEESIPIIDVSRMHSPDIADRQALAEEIREAAHSIGFFCMTNHGIDMNLASNVMEQAREFFALPEEKKMEVSSELIPDEYCGYHGMYRYNPNGWKYRDLYEAFNWNYNPAKDPEYPDPSTPQINLWPKDMPEFEEKLGAYQTEMIRFARRLTRIFALALHVSEDFYDEHIKRPEAGLRILHYPQQEACRDEQNGIGAHTDVEFFTIITSDAEGLEVLSKSGRWIKVKPIPGCFVVNIADCFMRQTNDFFVSTVHRVINESDRERYSLPFFWGIDRKTLLNPIPTCVSDDNPNKYPVVTAGEYYLWRTRKQKWSWKVGENGDEAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.46
3 0.46
4 0.5
5 0.57
6 0.62
7 0.58
8 0.53
9 0.49
10 0.47
11 0.4
12 0.33
13 0.26
14 0.21
15 0.21
16 0.21
17 0.2
18 0.18
19 0.16
20 0.16
21 0.13
22 0.12
23 0.12
24 0.1
25 0.1
26 0.1
27 0.09
28 0.12
29 0.19
30 0.2
31 0.2
32 0.21
33 0.21
34 0.28
35 0.33
36 0.31
37 0.25
38 0.24
39 0.25
40 0.23
41 0.23
42 0.16
43 0.11
44 0.09
45 0.09
46 0.09
47 0.09
48 0.09
49 0.09
50 0.1
51 0.09
52 0.09
53 0.09
54 0.1
55 0.09
56 0.09
57 0.11
58 0.11
59 0.11
60 0.11
61 0.1
62 0.1
63 0.1
64 0.11
65 0.08
66 0.08
67 0.07
68 0.07
69 0.07
70 0.08
71 0.08
72 0.07
73 0.06
74 0.08
75 0.09
76 0.1
77 0.1
78 0.09
79 0.13
80 0.18
81 0.19
82 0.22
83 0.23
84 0.22
85 0.23
86 0.23
87 0.21
88 0.16
89 0.18
90 0.15
91 0.15
92 0.15
93 0.14
94 0.14
95 0.13
96 0.13
97 0.1
98 0.09
99 0.08
100 0.08
101 0.1
102 0.11
103 0.13
104 0.15
105 0.21
106 0.22
107 0.26
108 0.29
109 0.31
110 0.37
111 0.38
112 0.4
113 0.38
114 0.38
115 0.4
116 0.38
117 0.38
118 0.33
119 0.38
120 0.33
121 0.33
122 0.3
123 0.26
124 0.27
125 0.24
126 0.23
127 0.18
128 0.22
129 0.21
130 0.25
131 0.3
132 0.34
133 0.35
134 0.33
135 0.34
136 0.31
137 0.3
138 0.26
139 0.21
140 0.22
141 0.27
142 0.27
143 0.26
144 0.26
145 0.25
146 0.27
147 0.26
148 0.22
149 0.2
150 0.21
151 0.19
152 0.2
153 0.19
154 0.17
155 0.17
156 0.14
157 0.09
158 0.11
159 0.11
160 0.1
161 0.11
162 0.11
163 0.13
164 0.13
165 0.15
166 0.16
167 0.18
168 0.18
169 0.2
170 0.21
171 0.2
172 0.2
173 0.19
174 0.16
175 0.14
176 0.13
177 0.11
178 0.09
179 0.08
180 0.08
181 0.09
182 0.06
183 0.07
184 0.12
185 0.11
186 0.15
187 0.17
188 0.18
189 0.17
190 0.18
191 0.21
192 0.18
193 0.2
194 0.18
195 0.18
196 0.21
197 0.22
198 0.24
199 0.2
200 0.19
201 0.19
202 0.23
203 0.23
204 0.22
205 0.23
206 0.25
207 0.25
208 0.24
209 0.23
210 0.2
211 0.18
212 0.17
213 0.15
214 0.1
215 0.1
216 0.09
217 0.09
218 0.06
219 0.06
220 0.06
221 0.05
222 0.05
223 0.05
224 0.05
225 0.05
226 0.06
227 0.05
228 0.05
229 0.05
230 0.05
231 0.05
232 0.06
233 0.06
234 0.06
235 0.06
236 0.06
237 0.08
238 0.14
239 0.18
240 0.2
241 0.23
242 0.32
243 0.39
244 0.48
245 0.5
246 0.5
247 0.49
248 0.48
249 0.47
250 0.38
251 0.33
252 0.26
253 0.23
254 0.19
255 0.16
256 0.14
257 0.12
258 0.14
259 0.14
260 0.13
261 0.12
262 0.14
263 0.16
264 0.19
265 0.2
266 0.17
267 0.18
268 0.21
269 0.22
270 0.23
271 0.19
272 0.17
273 0.18
274 0.2
275 0.27
276 0.29
277 0.31
278 0.33
279 0.33
280 0.36
281 0.35
282 0.36
283 0.33
284 0.29
285 0.29
286 0.28
287 0.27
288 0.31
289 0.36
290 0.34
291 0.35
292 0.33
293 0.32
294 0.3
295 0.36
296 0.33
297 0.35
298 0.34
299 0.33
300 0.35
301 0.34
302 0.36
303 0.31
304 0.31
305 0.32
306 0.38
307 0.42
308 0.42
309 0.43
310 0.39
311 0.37
312 0.36
313 0.29
314 0.29
315 0.23
316 0.2
317 0.2
318 0.22
319 0.23
320 0.26
321 0.3
322 0.26
323 0.31
324 0.36
325 0.43
326 0.51
327 0.61
328 0.67
329 0.7
330 0.79
331 0.82
332 0.84
333 0.83
334 0.8
335 0.76
336 0.67