Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7HSR5

Protein Details
Accession W7HSR5   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-39NKGYKVTRRDSKPRISRTKGKSSKRTLHydrophilic
60-83ELIRNSKDKRARKLAKKRLGTFGRBasic
NLS Segment(s)
PositionSequence
20-37RRDSKPRISRTKGKSSKR
63-87RNSKDKRARKLAKKRLGTFGRAKRK
Subcellular Location(s) mito 11, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAKEPTGLAVGVNKGYKVTRRDSKPRISRTKGKSSKRTLFVREIVKEVAGLAPYEKRVIELIRNSKDKRARKLAKKRLGTFGRAKRKVDELTRVIAESRRAGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.24
4 0.25
5 0.32
6 0.38
7 0.45
8 0.56
9 0.62
10 0.7
11 0.74
12 0.8
13 0.81
14 0.8
15 0.81
16 0.79
17 0.82
18 0.81
19 0.81
20 0.8
21 0.79
22 0.8
23 0.78
24 0.75
25 0.69
26 0.65
27 0.61
28 0.58
29 0.5
30 0.44
31 0.36
32 0.31
33 0.25
34 0.2
35 0.15
36 0.09
37 0.07
38 0.06
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.08
45 0.09
46 0.13
47 0.19
48 0.26
49 0.31
50 0.38
51 0.38
52 0.44
53 0.52
54 0.55
55 0.56
56 0.6
57 0.64
58 0.69
59 0.79
60 0.83
61 0.84
62 0.86
63 0.82
64 0.81
65 0.76
66 0.72
67 0.7
68 0.7
69 0.71
70 0.68
71 0.66
72 0.59
73 0.61
74 0.61
75 0.58
76 0.57
77 0.49
78 0.49
79 0.48
80 0.45
81 0.4
82 0.36
83 0.33