Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7HS88

Protein Details
Accession W7HS88    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
126-152ASIVTPPPRRRGRPPRKAGRKAAGDSSHydrophilic
NLS Segment(s)
PositionSequence
99-106AKRRKGRK
132-148PPRRRGRPPRKAGRKAA
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MTRVKAAKRTPSPGVPLATPKSQKLIHSSARALTPADRRMLDIEATPSRASFRKAMSRIQLASLKKTTGKRLASTAMVVSPFSTQAGGGVQLSPSAAAAKRRKGRKATEEVVVKEDNDAGLATAAASIVTPPPRRRGRPPRKAGRKAAGDSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.47
3 0.46
4 0.44
5 0.45
6 0.43
7 0.38
8 0.38
9 0.38
10 0.38
11 0.39
12 0.42
13 0.41
14 0.43
15 0.44
16 0.41
17 0.39
18 0.38
19 0.32
20 0.29
21 0.29
22 0.27
23 0.28
24 0.26
25 0.26
26 0.27
27 0.27
28 0.23
29 0.18
30 0.19
31 0.18
32 0.19
33 0.18
34 0.16
35 0.17
36 0.18
37 0.19
38 0.18
39 0.2
40 0.27
41 0.29
42 0.34
43 0.36
44 0.38
45 0.36
46 0.37
47 0.38
48 0.3
49 0.32
50 0.29
51 0.26
52 0.26
53 0.28
54 0.3
55 0.32
56 0.33
57 0.3
58 0.31
59 0.32
60 0.28
61 0.26
62 0.21
63 0.14
64 0.12
65 0.11
66 0.09
67 0.07
68 0.06
69 0.06
70 0.06
71 0.04
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.04
81 0.04
82 0.05
83 0.06
84 0.14
85 0.19
86 0.27
87 0.35
88 0.42
89 0.49
90 0.54
91 0.62
92 0.63
93 0.68
94 0.63
95 0.63
96 0.62
97 0.57
98 0.53
99 0.46
100 0.36
101 0.28
102 0.25
103 0.17
104 0.12
105 0.1
106 0.06
107 0.06
108 0.05
109 0.05
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.07
116 0.14
117 0.2
118 0.23
119 0.33
120 0.42
121 0.48
122 0.59
123 0.67
124 0.73
125 0.78
126 0.86
127 0.87
128 0.9
129 0.94
130 0.92
131 0.9
132 0.88