Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7HS45

Protein Details
Accession W7HS45    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
255-280GSQYAQDIKRRKERPKSILKNPISFDHydrophilic
NLS Segment(s)
PositionSequence
263-270KRRKERPK
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MASYPRDAPTWSGQAGGYYTYSAAPVSHVPLSSSPRMQTTPRSAPAYDQLAVMMPRQTTLEAYMHKTFKDFADHAYTCDVCYDPLRVQMEGGRLCSRGNKLARKISKAFHEEANEKYHRVNSSRHHTAVWKSIGAEIPEGCEIVRPLINAMNRGLDISSRSDDSHHTYYQRRPGPSSDEELYSRSRSRHRDELETAGRSRSAKRSSSAGNAVRKPVVIGIQERERRPYGGSHSSHGSTDSGYDTAPGSPDTFRRGSQYAQDIKRRKERPKSILKNPISFDEREHLLEKDPKAPRSPIKGTSQEKCVFFKISGEHIPPGFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.22
4 0.16
5 0.12
6 0.12
7 0.11
8 0.11
9 0.1
10 0.09
11 0.1
12 0.11
13 0.14
14 0.16
15 0.15
16 0.17
17 0.21
18 0.27
19 0.3
20 0.31
21 0.29
22 0.31
23 0.33
24 0.35
25 0.38
26 0.41
27 0.45
28 0.48
29 0.5
30 0.47
31 0.47
32 0.5
33 0.47
34 0.38
35 0.3
36 0.24
37 0.23
38 0.23
39 0.21
40 0.18
41 0.13
42 0.13
43 0.13
44 0.14
45 0.12
46 0.15
47 0.17
48 0.18
49 0.23
50 0.29
51 0.29
52 0.29
53 0.29
54 0.27
55 0.25
56 0.29
57 0.24
58 0.21
59 0.29
60 0.3
61 0.3
62 0.32
63 0.3
64 0.23
65 0.24
66 0.2
67 0.12
68 0.13
69 0.15
70 0.12
71 0.18
72 0.2
73 0.19
74 0.19
75 0.21
76 0.25
77 0.23
78 0.26
79 0.21
80 0.2
81 0.2
82 0.24
83 0.24
84 0.26
85 0.32
86 0.36
87 0.41
88 0.5
89 0.55
90 0.57
91 0.58
92 0.54
93 0.55
94 0.52
95 0.47
96 0.42
97 0.42
98 0.38
99 0.37
100 0.4
101 0.33
102 0.29
103 0.28
104 0.28
105 0.26
106 0.27
107 0.3
108 0.3
109 0.38
110 0.42
111 0.42
112 0.39
113 0.4
114 0.4
115 0.41
116 0.35
117 0.27
118 0.22
119 0.23
120 0.24
121 0.21
122 0.19
123 0.12
124 0.11
125 0.11
126 0.11
127 0.08
128 0.07
129 0.07
130 0.07
131 0.08
132 0.06
133 0.07
134 0.1
135 0.11
136 0.12
137 0.12
138 0.12
139 0.11
140 0.11
141 0.1
142 0.07
143 0.08
144 0.09
145 0.09
146 0.09
147 0.1
148 0.1
149 0.12
150 0.17
151 0.2
152 0.19
153 0.21
154 0.25
155 0.29
156 0.36
157 0.4
158 0.36
159 0.34
160 0.35
161 0.38
162 0.37
163 0.37
164 0.3
165 0.27
166 0.26
167 0.26
168 0.26
169 0.22
170 0.22
171 0.2
172 0.25
173 0.29
174 0.34
175 0.41
176 0.43
177 0.47
178 0.47
179 0.52
180 0.51
181 0.48
182 0.42
183 0.34
184 0.33
185 0.27
186 0.28
187 0.27
188 0.27
189 0.27
190 0.28
191 0.31
192 0.32
193 0.36
194 0.41
195 0.4
196 0.42
197 0.41
198 0.42
199 0.38
200 0.35
201 0.3
202 0.24
203 0.21
204 0.16
205 0.17
206 0.19
207 0.27
208 0.32
209 0.33
210 0.36
211 0.34
212 0.33
213 0.32
214 0.32
215 0.3
216 0.34
217 0.35
218 0.33
219 0.35
220 0.35
221 0.34
222 0.31
223 0.24
224 0.15
225 0.15
226 0.14
227 0.11
228 0.09
229 0.1
230 0.09
231 0.09
232 0.1
233 0.1
234 0.09
235 0.11
236 0.13
237 0.18
238 0.19
239 0.19
240 0.23
241 0.25
242 0.26
243 0.3
244 0.37
245 0.41
246 0.46
247 0.55
248 0.58
249 0.63
250 0.71
251 0.73
252 0.74
253 0.76
254 0.79
255 0.8
256 0.84
257 0.86
258 0.86
259 0.89
260 0.85
261 0.81
262 0.73
263 0.7
264 0.62
265 0.53
266 0.46
267 0.4
268 0.37
269 0.33
270 0.33
271 0.27
272 0.29
273 0.35
274 0.34
275 0.38
276 0.42
277 0.43
278 0.46
279 0.52
280 0.53
281 0.56
282 0.6
283 0.58
284 0.6
285 0.66
286 0.68
287 0.66
288 0.68
289 0.65
290 0.62
291 0.59
292 0.53
293 0.47
294 0.4
295 0.39
296 0.34
297 0.34
298 0.37
299 0.37
300 0.38