Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7IH01

Protein Details
Accession W7IH01    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
79-114MQALSVKRQRKLKMKKHKYKKLMKRTRTLRRKLEKQBasic
NLS Segment(s)
PositionSequence
85-114KRQRKLKMKKHKYKKLMKRTRTLRRKLEKQ
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 8.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MMNPVLFNQYLPFQPPPPPQPIPEAVLKAPFQQLKSIRVINDRTADGGYIVTFIPLDGSGRLAGGGRKRVMMHSRQPTMQALSVKRQRKLKMKKHKYKKLMKRTRTLRRKLEKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.35
3 0.38
4 0.42
5 0.44
6 0.41
7 0.44
8 0.45
9 0.4
10 0.38
11 0.36
12 0.29
13 0.3
14 0.29
15 0.25
16 0.27
17 0.27
18 0.23
19 0.27
20 0.29
21 0.29
22 0.33
23 0.33
24 0.3
25 0.33
26 0.35
27 0.31
28 0.31
29 0.28
30 0.24
31 0.22
32 0.2
33 0.15
34 0.12
35 0.08
36 0.06
37 0.06
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.05
50 0.07
51 0.1
52 0.14
53 0.14
54 0.15
55 0.16
56 0.2
57 0.24
58 0.28
59 0.34
60 0.38
61 0.41
62 0.4
63 0.42
64 0.4
65 0.37
66 0.35
67 0.31
68 0.26
69 0.32
70 0.4
71 0.44
72 0.47
73 0.52
74 0.56
75 0.61
76 0.7
77 0.72
78 0.75
79 0.81
80 0.86
81 0.91
82 0.94
83 0.93
84 0.94
85 0.94
86 0.94
87 0.93
88 0.91
89 0.91
90 0.91
91 0.91
92 0.91
93 0.9
94 0.89