Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7I6T3

Protein Details
Accession W7I6T3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
56-81TYSQVLRGCRRPKKSHNRKPISPQITHydrophilic
NLS Segment(s)
PositionSequence
66-75RPKKSHNRKP
97-107KPKKPNSGERK
Subcellular Location(s) mito 21, nucl 4.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences MITRKTFGFLSRHLFSPSASLSLRHTITRPTPFLQPVVPRLPALHAFSTSPLAQATYSQVLRGCRRPKKSHNRKPISPQITGRPGLKGVCLRVGTTKPKKPNSGERKIARVKLSSGNVITAYIPGEGHNIQTHSVVMVRGGRSQDCPGVRYHLVRGAYDLGGVPNRATSRSKYGTKKSKTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.31
3 0.31
4 0.27
5 0.24
6 0.21
7 0.2
8 0.21
9 0.26
10 0.28
11 0.25
12 0.25
13 0.26
14 0.33
15 0.38
16 0.39
17 0.35
18 0.39
19 0.39
20 0.4
21 0.38
22 0.36
23 0.35
24 0.35
25 0.34
26 0.29
27 0.28
28 0.29
29 0.28
30 0.27
31 0.23
32 0.19
33 0.19
34 0.2
35 0.22
36 0.19
37 0.16
38 0.12
39 0.11
40 0.1
41 0.1
42 0.12
43 0.13
44 0.13
45 0.14
46 0.16
47 0.2
48 0.24
49 0.31
50 0.38
51 0.41
52 0.5
53 0.58
54 0.66
55 0.74
56 0.81
57 0.84
58 0.86
59 0.86
60 0.83
61 0.84
62 0.83
63 0.76
64 0.69
65 0.61
66 0.56
67 0.53
68 0.49
69 0.4
70 0.31
71 0.27
72 0.23
73 0.22
74 0.17
75 0.13
76 0.15
77 0.15
78 0.14
79 0.16
80 0.19
81 0.26
82 0.32
83 0.38
84 0.42
85 0.47
86 0.52
87 0.54
88 0.61
89 0.62
90 0.63
91 0.66
92 0.61
93 0.65
94 0.64
95 0.64
96 0.56
97 0.48
98 0.42
99 0.39
100 0.38
101 0.32
102 0.27
103 0.24
104 0.21
105 0.2
106 0.17
107 0.11
108 0.1
109 0.07
110 0.07
111 0.06
112 0.09
113 0.08
114 0.1
115 0.11
116 0.11
117 0.12
118 0.12
119 0.12
120 0.1
121 0.11
122 0.09
123 0.09
124 0.12
125 0.12
126 0.15
127 0.17
128 0.18
129 0.2
130 0.22
131 0.26
132 0.24
133 0.24
134 0.23
135 0.27
136 0.29
137 0.28
138 0.28
139 0.28
140 0.28
141 0.27
142 0.28
143 0.25
144 0.23
145 0.21
146 0.19
147 0.15
148 0.16
149 0.16
150 0.14
151 0.15
152 0.16
153 0.18
154 0.21
155 0.23
156 0.3
157 0.37
158 0.46
159 0.51
160 0.61
161 0.68