Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7I326

Protein Details
Accession W7I326    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-27SSQHNQSRKAHRNGIKKPKTFHydrophilic
NLS Segment(s)
PositionSequence
14-51RKAHRNGIKKPKTFRYPSLKGTDPKFRRNHKHALHGTA
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSRKAHRNGIKKPKTFRYPSLKGTDPKFRRNHKHALHGTAKALKEFKAGERETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.79
4 0.77
5 0.79
6 0.8
7 0.83
8 0.81
9 0.78
10 0.78
11 0.77
12 0.77
13 0.72
14 0.7
15 0.68
16 0.64
17 0.63
18 0.62
19 0.57
20 0.52
21 0.51
22 0.53
23 0.48
24 0.51
25 0.54
26 0.58
27 0.63
28 0.65
29 0.71
30 0.66
31 0.73
32 0.69
33 0.69
34 0.65
35 0.58
36 0.56
37 0.52
38 0.47
39 0.4
40 0.37
41 0.29
42 0.27
43 0.27
44 0.28
45 0.32