Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6Q1B2

Protein Details
Accession B6Q1B2    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
12-40LLWKIPWRLSSRQKFRQRKRLRSVDNVVDHydrophilic
79-100YDRKEKTYRKGIHKLPKWTRVSBasic
NLS Segment(s)
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG tmf:PMAA_016940  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKATSPLLGGLLWKIPWRLSSRQKFRQRKRLRSVDNVVDTIAAALERNGLPQVKAVERWYAEMPREEEMLPKDKYSIYDRKEKTYRKGIHKLPKWTRVSQRINPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.18
5 0.23
6 0.3
7 0.39
8 0.49
9 0.57
10 0.66
11 0.76
12 0.83
13 0.88
14 0.9
15 0.9
16 0.9
17 0.91
18 0.91
19 0.87
20 0.85
21 0.82
22 0.78
23 0.7
24 0.6
25 0.5
26 0.39
27 0.32
28 0.22
29 0.15
30 0.07
31 0.04
32 0.03
33 0.05
34 0.05
35 0.05
36 0.06
37 0.07
38 0.07
39 0.08
40 0.11
41 0.1
42 0.11
43 0.12
44 0.14
45 0.14
46 0.16
47 0.17
48 0.17
49 0.17
50 0.19
51 0.19
52 0.18
53 0.19
54 0.16
55 0.17
56 0.18
57 0.23
58 0.21
59 0.19
60 0.19
61 0.19
62 0.22
63 0.26
64 0.31
65 0.29
66 0.39
67 0.41
68 0.48
69 0.56
70 0.59
71 0.61
72 0.63
73 0.68
74 0.67
75 0.75
76 0.76
77 0.78
78 0.8
79 0.83
80 0.82
81 0.83
82 0.79
83 0.78
84 0.79
85 0.79
86 0.8
87 0.77
88 0.79