Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7HWC0

Protein Details
Accession W7HWC0    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-93QKLAAHKKKQYGKSKPTLLKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007727  Spo12  
Pfam View protein in Pfam  
PF05032  Spo12  
Amino Acid Sequences MSTPQSAQQIEENTNMSSTNSPAASIEPLHQLEGTPADSLEEQRRLLQQKLAEQAANAEKFSSPTDSVMSPCSQKLAAHKKKQYGKSKPTLLKSAFAQVAASQENRAPKQRDDTDESPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.18
4 0.16
5 0.14
6 0.15
7 0.13
8 0.13
9 0.13
10 0.14
11 0.14
12 0.14
13 0.14
14 0.16
15 0.16
16 0.16
17 0.16
18 0.15
19 0.14
20 0.15
21 0.14
22 0.09
23 0.08
24 0.09
25 0.09
26 0.11
27 0.15
28 0.15
29 0.15
30 0.16
31 0.21
32 0.23
33 0.24
34 0.25
35 0.23
36 0.25
37 0.28
38 0.28
39 0.23
40 0.2
41 0.22
42 0.22
43 0.21
44 0.16
45 0.13
46 0.12
47 0.13
48 0.14
49 0.13
50 0.09
51 0.1
52 0.11
53 0.11
54 0.12
55 0.13
56 0.13
57 0.12
58 0.12
59 0.12
60 0.11
61 0.12
62 0.2
63 0.3
64 0.38
65 0.46
66 0.52
67 0.59
68 0.67
69 0.76
70 0.77
71 0.76
72 0.76
73 0.76
74 0.8
75 0.78
76 0.75
77 0.74
78 0.65
79 0.58
80 0.51
81 0.48
82 0.39
83 0.33
84 0.28
85 0.2
86 0.22
87 0.2
88 0.19
89 0.14
90 0.16
91 0.23
92 0.26
93 0.34
94 0.35
95 0.37
96 0.46
97 0.52
98 0.56
99 0.58