Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6QPU9

Protein Details
Accession B6QPU9    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-40NWYIVEDRKQRKRIQDRLAQRARRKRLAEHydrophilic
NLS Segment(s)
PositionSequence
19-45RKQRKRIQDRLAQRARRKRLAELKIGR
Subcellular Location(s) nucl 14.5, mito_nucl 8.5, cyto 8, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021833  DUF3425  
KEGG tmf:PMAA_039320  -  
Pfam View protein in Pfam  
PF11905  DUF3425  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MVRPKNKEEADNWYIVEDRKQRKRIQDRLAQRARRKRLAELKIGRSGKDPVVAENASLLALSTSAGGHPALREEMSLGCNSPVGSLIPIPPAKGKPLEIELSMNVWTALYLNGSIMGLSCSTAYPAKSRPVDPSIPSTLQPTVLQLMTIHPTWIDRFPFPEMRDNLINAISLVEEEDFLRDLFCMSSFKIKPGGATWDPDAWIIGEAFRAKWGFLFTEQLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.34
4 0.34
5 0.39
6 0.47
7 0.54
8 0.59
9 0.68
10 0.77
11 0.79
12 0.8
13 0.8
14 0.8
15 0.83
16 0.87
17 0.85
18 0.84
19 0.84
20 0.83
21 0.83
22 0.76
23 0.75
24 0.75
25 0.73
26 0.74
27 0.72
28 0.7
29 0.7
30 0.68
31 0.59
32 0.52
33 0.48
34 0.39
35 0.36
36 0.3
37 0.22
38 0.27
39 0.26
40 0.23
41 0.2
42 0.18
43 0.12
44 0.11
45 0.1
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.05
55 0.05
56 0.07
57 0.07
58 0.07
59 0.07
60 0.08
61 0.09
62 0.1
63 0.1
64 0.09
65 0.08
66 0.09
67 0.09
68 0.08
69 0.07
70 0.06
71 0.06
72 0.07
73 0.07
74 0.11
75 0.11
76 0.12
77 0.13
78 0.14
79 0.15
80 0.16
81 0.16
82 0.14
83 0.17
84 0.17
85 0.16
86 0.16
87 0.14
88 0.14
89 0.13
90 0.11
91 0.08
92 0.07
93 0.06
94 0.05
95 0.05
96 0.04
97 0.03
98 0.03
99 0.04
100 0.04
101 0.04
102 0.03
103 0.04
104 0.03
105 0.04
106 0.04
107 0.04
108 0.05
109 0.07
110 0.07
111 0.09
112 0.12
113 0.18
114 0.2
115 0.21
116 0.25
117 0.28
118 0.31
119 0.3
120 0.32
121 0.31
122 0.3
123 0.29
124 0.27
125 0.23
126 0.21
127 0.19
128 0.16
129 0.13
130 0.12
131 0.11
132 0.09
133 0.1
134 0.11
135 0.11
136 0.1
137 0.08
138 0.1
139 0.11
140 0.15
141 0.16
142 0.14
143 0.16
144 0.21
145 0.27
146 0.28
147 0.34
148 0.33
149 0.35
150 0.36
151 0.34
152 0.31
153 0.26
154 0.24
155 0.15
156 0.13
157 0.09
158 0.07
159 0.07
160 0.05
161 0.05
162 0.05
163 0.06
164 0.07
165 0.07
166 0.07
167 0.06
168 0.07
169 0.07
170 0.08
171 0.09
172 0.1
173 0.19
174 0.2
175 0.22
176 0.27
177 0.27
178 0.28
179 0.29
180 0.36
181 0.28
182 0.32
183 0.32
184 0.29
185 0.29
186 0.28
187 0.25
188 0.17
189 0.16
190 0.13
191 0.1
192 0.11
193 0.12
194 0.12
195 0.15
196 0.15
197 0.14
198 0.15
199 0.17
200 0.17
201 0.18