Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7HUV8

Protein Details
Accession W7HUV8   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
61-81ETAHRMTKIEKKPRKNLQYKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MPYNTNPIPRKEKPEWDGTSYLPLARVRKIIKLDPDIDACTPAAAFLIAVAAESFIWDFSETAHRMTKIEKKPRKNLQYKDLANAVARFDNLEFMTDVVPRTVTFAKALQQKRDVGAGKTKKKTTGEQGNGEGTSAAKDGDLANTSGQEENSSDAGSPSETTRLKNLHLSNQTGGSGDKKAKTSSSMDQDGDLVMQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.66
3 0.63
4 0.59
5 0.51
6 0.5
7 0.41
8 0.37
9 0.3
10 0.3
11 0.27
12 0.27
13 0.32
14 0.29
15 0.34
16 0.38
17 0.4
18 0.43
19 0.47
20 0.46
21 0.43
22 0.44
23 0.4
24 0.35
25 0.31
26 0.23
27 0.17
28 0.14
29 0.11
30 0.08
31 0.06
32 0.05
33 0.03
34 0.04
35 0.03
36 0.04
37 0.03
38 0.04
39 0.03
40 0.04
41 0.04
42 0.04
43 0.04
44 0.05
45 0.05
46 0.06
47 0.13
48 0.13
49 0.15
50 0.18
51 0.18
52 0.18
53 0.23
54 0.31
55 0.34
56 0.44
57 0.51
58 0.57
59 0.66
60 0.76
61 0.82
62 0.82
63 0.78
64 0.76
65 0.78
66 0.7
67 0.64
68 0.55
69 0.46
70 0.38
71 0.32
72 0.25
73 0.15
74 0.13
75 0.11
76 0.09
77 0.1
78 0.08
79 0.08
80 0.07
81 0.07
82 0.08
83 0.08
84 0.08
85 0.06
86 0.06
87 0.05
88 0.08
89 0.09
90 0.08
91 0.09
92 0.1
93 0.15
94 0.23
95 0.26
96 0.27
97 0.29
98 0.3
99 0.3
100 0.34
101 0.31
102 0.24
103 0.31
104 0.36
105 0.41
106 0.46
107 0.47
108 0.47
109 0.48
110 0.51
111 0.51
112 0.53
113 0.51
114 0.49
115 0.5
116 0.47
117 0.44
118 0.39
119 0.3
120 0.19
121 0.14
122 0.1
123 0.07
124 0.05
125 0.06
126 0.06
127 0.07
128 0.09
129 0.09
130 0.09
131 0.09
132 0.11
133 0.11
134 0.11
135 0.1
136 0.09
137 0.11
138 0.11
139 0.11
140 0.1
141 0.09
142 0.1
143 0.1
144 0.1
145 0.09
146 0.15
147 0.16
148 0.18
149 0.23
150 0.25
151 0.27
152 0.34
153 0.36
154 0.38
155 0.43
156 0.45
157 0.42
158 0.41
159 0.39
160 0.32
161 0.3
162 0.23
163 0.23
164 0.24
165 0.25
166 0.26
167 0.28
168 0.29
169 0.32
170 0.35
171 0.39
172 0.42
173 0.44
174 0.42
175 0.4
176 0.39