Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7I2F6

Protein Details
Accession W7I2F6    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
84-104IDKITPRKVRRYEKRYAGKSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 13.5, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR036770  Ankyrin_rpt-contain_sf  
IPR025676  Clr5_dom  
Pfam View protein in Pfam  
PF14420  Clr5  
Amino Acid Sequences MGKPWETYKHEIFRYYIEEGRPLAEVREILRTQYNFEACKRSYQNQIEVWGFKKNVRSADMRAYLEQKLHNVPDSEMGLSQDVIDKITPRKVRRYEKRYAGKSSPSHEAASPREGRRLDDYEAAWGQEIFDYPESFPVTPSHGSEEPYFDNGILSSYPNYDSRLSYSEATLGEPIYASTGEYGALGSLTATDYGYRSSHDAHQPRPSDAPYHGPAGVSQPAQTSGSIELMKAALGGRVEDVRKSLAGGENPNVADRDGNTPLHYLVRGFHKLLDRASGVPGVLSGERRVEGSEFEKRIAAFGSSLGLLVGYGAKALPNRNGDTAVHMATSRLALYLENPLNANTGVHREWRSFVDVIQTAAAVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.45
3 0.41
4 0.34
5 0.34
6 0.31
7 0.31
8 0.28
9 0.24
10 0.2
11 0.18
12 0.18
13 0.16
14 0.24
15 0.23
16 0.23
17 0.3
18 0.29
19 0.31
20 0.36
21 0.39
22 0.34
23 0.37
24 0.43
25 0.37
26 0.45
27 0.48
28 0.45
29 0.51
30 0.54
31 0.58
32 0.53
33 0.58
34 0.52
35 0.49
36 0.46
37 0.43
38 0.38
39 0.34
40 0.37
41 0.36
42 0.37
43 0.38
44 0.41
45 0.39
46 0.47
47 0.5
48 0.45
49 0.44
50 0.42
51 0.4
52 0.39
53 0.36
54 0.3
55 0.28
56 0.28
57 0.28
58 0.26
59 0.25
60 0.26
61 0.26
62 0.23
63 0.19
64 0.18
65 0.15
66 0.14
67 0.13
68 0.13
69 0.11
70 0.11
71 0.11
72 0.13
73 0.16
74 0.23
75 0.3
76 0.31
77 0.4
78 0.49
79 0.6
80 0.68
81 0.72
82 0.74
83 0.78
84 0.84
85 0.81
86 0.79
87 0.73
88 0.7
89 0.67
90 0.61
91 0.57
92 0.49
93 0.45
94 0.39
95 0.39
96 0.33
97 0.36
98 0.39
99 0.34
100 0.37
101 0.36
102 0.36
103 0.37
104 0.38
105 0.34
106 0.31
107 0.3
108 0.28
109 0.28
110 0.25
111 0.2
112 0.15
113 0.13
114 0.1
115 0.1
116 0.07
117 0.08
118 0.09
119 0.09
120 0.12
121 0.14
122 0.13
123 0.14
124 0.13
125 0.15
126 0.15
127 0.16
128 0.18
129 0.17
130 0.19
131 0.19
132 0.21
133 0.19
134 0.19
135 0.19
136 0.14
137 0.12
138 0.1
139 0.1
140 0.07
141 0.07
142 0.06
143 0.07
144 0.09
145 0.09
146 0.12
147 0.12
148 0.12
149 0.14
150 0.16
151 0.17
152 0.16
153 0.15
154 0.15
155 0.14
156 0.14
157 0.12
158 0.1
159 0.08
160 0.07
161 0.07
162 0.05
163 0.05
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.04
179 0.04
180 0.06
181 0.06
182 0.07
183 0.08
184 0.09
185 0.14
186 0.22
187 0.25
188 0.28
189 0.34
190 0.35
191 0.36
192 0.36
193 0.33
194 0.28
195 0.25
196 0.27
197 0.22
198 0.22
199 0.21
200 0.19
201 0.18
202 0.19
203 0.2
204 0.14
205 0.13
206 0.11
207 0.12
208 0.13
209 0.12
210 0.11
211 0.09
212 0.11
213 0.11
214 0.1
215 0.1
216 0.09
217 0.09
218 0.08
219 0.07
220 0.06
221 0.06
222 0.06
223 0.06
224 0.09
225 0.1
226 0.1
227 0.11
228 0.11
229 0.11
230 0.11
231 0.12
232 0.13
233 0.15
234 0.18
235 0.18
236 0.2
237 0.21
238 0.21
239 0.19
240 0.16
241 0.14
242 0.13
243 0.16
244 0.16
245 0.17
246 0.17
247 0.17
248 0.18
249 0.19
250 0.17
251 0.13
252 0.13
253 0.19
254 0.21
255 0.21
256 0.24
257 0.28
258 0.3
259 0.31
260 0.31
261 0.26
262 0.24
263 0.25
264 0.22
265 0.16
266 0.14
267 0.13
268 0.11
269 0.11
270 0.11
271 0.1
272 0.11
273 0.12
274 0.12
275 0.13
276 0.12
277 0.14
278 0.18
279 0.25
280 0.25
281 0.25
282 0.27
283 0.25
284 0.26
285 0.24
286 0.2
287 0.12
288 0.11
289 0.11
290 0.09
291 0.09
292 0.08
293 0.07
294 0.06
295 0.06
296 0.06
297 0.04
298 0.04
299 0.04
300 0.06
301 0.09
302 0.12
303 0.18
304 0.23
305 0.26
306 0.27
307 0.3
308 0.29
309 0.31
310 0.32
311 0.27
312 0.22
313 0.19
314 0.18
315 0.17
316 0.17
317 0.12
318 0.09
319 0.09
320 0.08
321 0.1
322 0.18
323 0.19
324 0.2
325 0.2
326 0.2
327 0.22
328 0.22
329 0.21
330 0.14
331 0.18
332 0.18
333 0.24
334 0.27
335 0.27
336 0.29
337 0.32
338 0.35
339 0.3
340 0.29
341 0.31
342 0.3
343 0.29
344 0.26