Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7HP15

Protein Details
Accession W7HP15    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
44-75GDPLGLKAKGKRSRRRRRRRRGGKNAQAPPSABasic
NLS Segment(s)
PositionSequence
36-68KKRNLPPFGDPLGLKAKGKRSRRRRRRRRGGKN
Subcellular Location(s) nucl 17, cyto_nucl 15, cyto 9
Family & Domain DBs
Amino Acid Sequences MVSTHGSRVSRNGEGLYQGNKTEEKGRTEEREPQLKKRNLPPFGDPLGLKAKGKRSRRRRRRRRGGKNAQAPPSANLAAHSDAWARAQVSLPDLTASPVAIEEYLHEPEVFVVSPRQRPIRGYFHLQNARGGRIPYPALADVDDLVAAPIEPESRYNSTGTTQIPYFLRGIFATRVSETLESDGESGMKADPDRCVEFQTLNHTSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.29
4 0.25
5 0.23
6 0.24
7 0.23
8 0.24
9 0.28
10 0.3
11 0.31
12 0.34
13 0.4
14 0.43
15 0.47
16 0.54
17 0.54
18 0.59
19 0.59
20 0.63
21 0.67
22 0.67
23 0.7
24 0.7
25 0.72
26 0.68
27 0.68
28 0.63
29 0.6
30 0.56
31 0.52
32 0.42
33 0.36
34 0.36
35 0.34
36 0.3
37 0.28
38 0.34
39 0.4
40 0.5
41 0.57
42 0.62
43 0.72
44 0.82
45 0.89
46 0.91
47 0.94
48 0.96
49 0.97
50 0.97
51 0.97
52 0.97
53 0.96
54 0.94
55 0.91
56 0.84
57 0.75
58 0.65
59 0.55
60 0.48
61 0.38
62 0.27
63 0.2
64 0.18
65 0.16
66 0.15
67 0.14
68 0.1
69 0.1
70 0.1
71 0.11
72 0.08
73 0.08
74 0.09
75 0.08
76 0.09
77 0.09
78 0.09
79 0.08
80 0.08
81 0.08
82 0.07
83 0.07
84 0.05
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.07
91 0.08
92 0.08
93 0.08
94 0.08
95 0.08
96 0.09
97 0.07
98 0.05
99 0.08
100 0.11
101 0.14
102 0.17
103 0.19
104 0.2
105 0.22
106 0.28
107 0.33
108 0.33
109 0.38
110 0.39
111 0.45
112 0.5
113 0.48
114 0.47
115 0.41
116 0.39
117 0.34
118 0.31
119 0.23
120 0.2
121 0.2
122 0.15
123 0.16
124 0.15
125 0.13
126 0.13
127 0.12
128 0.1
129 0.09
130 0.08
131 0.06
132 0.05
133 0.04
134 0.04
135 0.03
136 0.03
137 0.04
138 0.05
139 0.06
140 0.11
141 0.14
142 0.16
143 0.16
144 0.17
145 0.18
146 0.21
147 0.21
148 0.2
149 0.17
150 0.2
151 0.2
152 0.21
153 0.2
154 0.17
155 0.17
156 0.14
157 0.17
158 0.16
159 0.17
160 0.17
161 0.17
162 0.17
163 0.18
164 0.19
165 0.17
166 0.17
167 0.16
168 0.14
169 0.14
170 0.13
171 0.11
172 0.1
173 0.1
174 0.08
175 0.1
176 0.11
177 0.12
178 0.15
179 0.2
180 0.25
181 0.25
182 0.28
183 0.28
184 0.29
185 0.3
186 0.36