Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7I5P3

Protein Details
Accession W7I5P3   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MKRNPRKLKWTKAFRKSANKEMIVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Amino Acid Sequences MKRNPRKLKWTKAFRKSANKEMIVDSTLSFAARRNIPTRYSRELIATTLKTMQRVSELHEKRERAFYRQRMAGNSAARRAADRKLVEENQHMLPEVRARLSQAGIETAETDESEAISNEDAYAVALPKTGALRKRQRALEQDSMDIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.86
4 0.85
5 0.83
6 0.75
7 0.67
8 0.6
9 0.53
10 0.43
11 0.36
12 0.26
13 0.19
14 0.16
15 0.14
16 0.11
17 0.11
18 0.15
19 0.17
20 0.21
21 0.23
22 0.26
23 0.3
24 0.37
25 0.41
26 0.43
27 0.41
28 0.38
29 0.38
30 0.36
31 0.33
32 0.32
33 0.26
34 0.2
35 0.24
36 0.23
37 0.22
38 0.21
39 0.19
40 0.17
41 0.17
42 0.21
43 0.26
44 0.28
45 0.33
46 0.38
47 0.38
48 0.36
49 0.45
50 0.41
51 0.37
52 0.44
53 0.44
54 0.44
55 0.48
56 0.48
57 0.41
58 0.42
59 0.4
60 0.36
61 0.32
62 0.28
63 0.24
64 0.22
65 0.22
66 0.2
67 0.18
68 0.2
69 0.19
70 0.2
71 0.25
72 0.27
73 0.28
74 0.29
75 0.3
76 0.25
77 0.25
78 0.23
79 0.17
80 0.15
81 0.16
82 0.15
83 0.13
84 0.12
85 0.13
86 0.14
87 0.14
88 0.14
89 0.11
90 0.12
91 0.11
92 0.11
93 0.1
94 0.09
95 0.09
96 0.08
97 0.08
98 0.06
99 0.06
100 0.07
101 0.06
102 0.06
103 0.06
104 0.07
105 0.06
106 0.06
107 0.06
108 0.06
109 0.06
110 0.07
111 0.06
112 0.07
113 0.07
114 0.08
115 0.12
116 0.16
117 0.21
118 0.3
119 0.41
120 0.49
121 0.58
122 0.63
123 0.68
124 0.71
125 0.75
126 0.75
127 0.67