Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6QMS4

Protein Details
Accession B6QMS4    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-39VGMRKNGKNWRTPKKPFRPTAGLKHydrophilic
88-116RYEKMAEKMHKKRVERRKRKEKRNKLLNSBasic
NLS Segment(s)
PositionSequence
19-44RKNGKNWRTPKKPFRPTAGLKSYEKR
53-112AMKEREKEMKDEKEAERQRHIQAIKDRRAAKAEKERYEKMAEKMHKKRVERRKRKEKRNK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
KEGG tmf:PMAA_060710  -  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSEVAVPVPGSGKTEVGMRKNGKNWRTPKKPFRPTAGLKSYEKRLQDRNNMAAMKEREKEMKDEKEAERQRHIQAIKDRRAAKAEKERYEKMAEKMHKKRVERRKRKEKRNKLLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.24
4 0.32
5 0.34
6 0.39
7 0.46
8 0.54
9 0.53
10 0.57
11 0.63
12 0.65
13 0.71
14 0.75
15 0.79
16 0.82
17 0.87
18 0.84
19 0.82
20 0.8
21 0.76
22 0.76
23 0.72
24 0.66
25 0.59
26 0.57
27 0.55
28 0.5
29 0.47
30 0.41
31 0.42
32 0.45
33 0.5
34 0.51
35 0.49
36 0.5
37 0.47
38 0.43
39 0.41
40 0.36
41 0.31
42 0.27
43 0.25
44 0.23
45 0.24
46 0.28
47 0.27
48 0.3
49 0.28
50 0.33
51 0.33
52 0.4
53 0.45
54 0.44
55 0.43
56 0.42
57 0.41
58 0.42
59 0.41
60 0.37
61 0.41
62 0.47
63 0.48
64 0.52
65 0.52
66 0.48
67 0.52
68 0.48
69 0.47
70 0.49
71 0.51
72 0.52
73 0.58
74 0.58
75 0.57
76 0.61
77 0.57
78 0.51
79 0.51
80 0.51
81 0.54
82 0.61
83 0.67
84 0.68
85 0.7
86 0.76
87 0.78
88 0.82
89 0.83
90 0.85
91 0.87
92 0.9
93 0.95
94 0.96
95 0.96
96 0.96