Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7HJF4

Protein Details
Accession W7HJF4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-75LDPNHRTRTNRSTRPPHRSFHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, mito 5, cyto 4, mito_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000261  EH_dom  
PROSITE View protein in PROSITE  
PS50031  EH  
Amino Acid Sequences MATSGLPQSQLARLWSLLVAVVASGSKCAQALPRSLARPPAKAQVTSHAPPPKPELDPNHRTRTNRSTRPPHRSFENLLASQYLDSVQLHGSASAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.14
4 0.12
5 0.09
6 0.07
7 0.05
8 0.05
9 0.05
10 0.04
11 0.05
12 0.05
13 0.05
14 0.05
15 0.06
16 0.11
17 0.13
18 0.16
19 0.19
20 0.24
21 0.25
22 0.26
23 0.34
24 0.32
25 0.33
26 0.32
27 0.36
28 0.33
29 0.33
30 0.32
31 0.3
32 0.34
33 0.31
34 0.35
35 0.33
36 0.31
37 0.31
38 0.35
39 0.31
40 0.27
41 0.31
42 0.33
43 0.36
44 0.44
45 0.49
46 0.54
47 0.55
48 0.55
49 0.57
50 0.59
51 0.61
52 0.61
53 0.64
54 0.67
55 0.72
56 0.81
57 0.79
58 0.73
59 0.69
60 0.65
61 0.61
62 0.58
63 0.57
64 0.47
65 0.43
66 0.4
67 0.34
68 0.29
69 0.24
70 0.16
71 0.1
72 0.09
73 0.09
74 0.09
75 0.1
76 0.1